Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4081197..4081723 | Replicon | chromosome |
| Accession | NZ_CP122319 | ||
| Organism | Escherichia coli strain BW25113 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | QCG47_RS19815 | Protein ID | WP_000323025.1 |
| Coordinates | 4081197..4081484 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | QCG47_RS19820 | Protein ID | WP_000534858.1 |
| Coordinates | 4081484..4081723 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG47_RS19765 (4076221) | 4076221..4076436 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| QCG47_RS19770 (4076656) | 4076656..4076826 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| QCG47_RS19775 (4077190) | 4077190..4077405 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| QCG47_RS19780 (4077706) | 4077706..4077918 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| QCG47_RS19785 (4077973) | 4077973..4078062 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| QCG47_RS19790 (4078340) | 4078340..4079092 | - | 753 | WP_001047135.1 | antitermination protein | - |
| QCG47_RS19795 (4079106) | 4079106..4080155 | - | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
| QCG47_RS19800 (4080157) | 4080157..4080435 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| QCG47_RS19805 (4080502) | 4080502..4080753 | - | 252 | WP_000980994.1 | protein Rem | - |
| QCG47_RS19810 (4080970) | 4080970..4081125 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| QCG47_RS19815 (4081197) | 4081197..4081484 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| QCG47_RS19820 (4081484) | 4081484..4081723 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| QCG47_RS19825 (4081748) | 4081748..4082053 | + | 306 | WP_001326990.1 | protein YdfV | - |
| QCG47_RS19830 (4082256) | 4082256..4082588 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
| QCG47_RS19835 (4083025) | 4083025..4083174 | - | 150 | WP_011443592.1 | protein YdfW | - |
| QCG47_RS19840 (4083209) | 4083209..4083487 | - | 279 | Protein_3856 | protein YdfX | - |
| QCG47_RS19845 (4083471) | 4083471..4083701 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
| QCG47_RS19850 (4083785) | 4083785..4084192 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
| QCG47_RS19855 (4084359) | 4084359..4084514 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
| QCG47_RS19860 (4084516) | 4084516..4084644 | + | 129 | WP_000344964.1 | protein YdfB | - |
| QCG47_RS19865 (4084674) | 4084674..4084892 | + | 219 | WP_001171942.1 | protein YdfC | - |
| QCG47_RS19870 (4085460) | 4085460..4085648 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
| QCG47_RS19875 (4085645) | 4085645..4085836 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
| QCG47_RS19880 (4085929) | 4085929..4086696 | + | 768 | Protein_3864 | exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 4066853..4089766 | 22913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T276777 WP_000323025.1 NZ_CP122319:c4081484-4081197 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|