Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
| Location | 2378894..2379306 | Replicon | chromosome |
| Accession | NZ_CP122319 | ||
| Organism | Escherichia coli strain BW25113 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | U9YSY7 |
| Locus tag | QCG47_RS11375 | Protein ID | WP_000132601.1 |
| Coordinates | 2378894..2379235 (-) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 2379230..2379306 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG47_RS11365 (2376307) | 2376307..2377353 | - | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
| QCG47_RS11370 (2377353) | 2377353..2378732 | - | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| QCG47_RS11375 (2378894) | 2378894..2379235 | - | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
| - (2379230) | 2379230..2379306 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (2379230) | 2379230..2379306 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (2379230) | 2379230..2379306 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (2379230) | 2379230..2379306 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (2379230) | 2379230..2379306 | + | 77 | NuclAT_15 | - | Antitoxin |
| - (2379230) | 2379230..2379306 | + | 77 | NuclAT_15 | - | Antitoxin |
| - (2379230) | 2379230..2379306 | + | 77 | NuclAT_15 | - | Antitoxin |
| - (2379230) | 2379230..2379306 | + | 77 | NuclAT_15 | - | Antitoxin |
| QCG47_RS11380 (2379463) | 2379463..2380857 | - | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
| QCG47_RS11385 (2380854) | 2380854..2382443 | - | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 2371809..2380857 | 9048 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T276758 WP_000132601.1 NZ_CP122319:c2379235-2378894 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT276758 NZ_CP122319:2379230-2379306 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|