Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
| Location | 2941318..2941730 | Replicon | chromosome |
| Accession | NZ_CP122318 | ||
| Organism | Escherichia coli strain HT873X1 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | U9YSY7 |
| Locus tag | QCG45_RS14660 | Protein ID | WP_000132601.1 |
| Coordinates | 2941318..2941659 (-) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 2941654..2941730 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG45_RS14650 (2938731) | 2938731..2939777 | - | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
| QCG45_RS14655 (2939777) | 2939777..2941156 | - | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| QCG45_RS14660 (2941318) | 2941318..2941659 | - | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
| - (2941654) | 2941654..2941730 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (2941654) | 2941654..2941730 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (2941654) | 2941654..2941730 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (2941654) | 2941654..2941730 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (2941654) | 2941654..2941730 | + | 77 | NuclAT_15 | - | Antitoxin |
| - (2941654) | 2941654..2941730 | + | 77 | NuclAT_15 | - | Antitoxin |
| - (2941654) | 2941654..2941730 | + | 77 | NuclAT_15 | - | Antitoxin |
| - (2941654) | 2941654..2941730 | + | 77 | NuclAT_15 | - | Antitoxin |
| QCG45_RS14665 (2941887) | 2941887..2943281 | - | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
| QCG45_RS14670 (2943278) | 2943278..2944867 | - | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 2934233..2943281 | 9048 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T276738 WP_000132601.1 NZ_CP122318:c2941659-2941318 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT276738 NZ_CP122318:2941654-2941730 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|