Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
Location | 2909519..2909931 | Replicon | chromosome |
Accession | NZ_CP122316 | ||
Organism | Escherichia coli strain HT-946 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | QCG48_RS14525 | Protein ID | WP_000132601.1 |
Coordinates | 2909519..2909860 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 2909855..2909931 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG48_RS14515 (2906932) | 2906932..2907978 | - | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
QCG48_RS14520 (2907978) | 2907978..2909357 | - | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
QCG48_RS14525 (2909519) | 2909519..2909860 | - | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
- (2909855) | 2909855..2909931 | + | 77 | NuclAT_14 | - | Antitoxin |
- (2909855) | 2909855..2909931 | + | 77 | NuclAT_14 | - | Antitoxin |
- (2909855) | 2909855..2909931 | + | 77 | NuclAT_14 | - | Antitoxin |
- (2909855) | 2909855..2909931 | + | 77 | NuclAT_14 | - | Antitoxin |
- (2909855) | 2909855..2909931 | + | 77 | NuclAT_15 | - | Antitoxin |
- (2909855) | 2909855..2909931 | + | 77 | NuclAT_15 | - | Antitoxin |
- (2909855) | 2909855..2909931 | + | 77 | NuclAT_15 | - | Antitoxin |
- (2909855) | 2909855..2909931 | + | 77 | NuclAT_15 | - | Antitoxin |
QCG48_RS14530 (2910088) | 2910088..2911482 | - | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
QCG48_RS14535 (2911479) | 2911479..2913068 | - | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2902434..2911482 | 9048 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T276676 WP_000132601.1 NZ_CP122316:c2909860-2909519 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT276676 NZ_CP122316:2909855-2909931 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|