Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3056796..3057322 | Replicon | chromosome |
Accession | NZ_CP122315 | ||
Organism | Escherichia coli strain HT-947 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | QCG46_RS15020 | Protein ID | WP_000323025.1 |
Coordinates | 3056796..3057083 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | QCG46_RS15025 | Protein ID | WP_000534858.1 |
Coordinates | 3057083..3057322 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG46_RS14970 (3051820) | 3051820..3052035 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
QCG46_RS14975 (3052255) | 3052255..3052425 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
QCG46_RS14980 (3052789) | 3052789..3053004 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
QCG46_RS14985 (3053305) | 3053305..3053517 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
QCG46_RS14990 (3053572) | 3053572..3053661 | + | 90 | WP_120795389.1 | hypothetical protein | - |
QCG46_RS14995 (3053939) | 3053939..3054691 | - | 753 | WP_001047135.1 | antitermination protein | - |
QCG46_RS15000 (3054705) | 3054705..3055754 | - | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
QCG46_RS15005 (3055756) | 3055756..3056034 | - | 279 | WP_012304870.1 | hypothetical protein | - |
QCG46_RS15010 (3056101) | 3056101..3056352 | - | 252 | WP_000980994.1 | protein Rem | - |
QCG46_RS15015 (3056569) | 3056569..3056724 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
QCG46_RS15020 (3056796) | 3056796..3057083 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
QCG46_RS15025 (3057083) | 3057083..3057322 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
QCG46_RS15030 (3057347) | 3057347..3057652 | + | 306 | WP_001326990.1 | protein YdfV | - |
QCG46_RS15035 (3057855) | 3057855..3058187 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
QCG46_RS15040 (3058624) | 3058624..3058773 | - | 150 | WP_011443592.1 | protein YdfW | - |
QCG46_RS15045 (3058808) | 3058808..3059086 | - | 279 | Protein_2923 | protein YdfX | - |
QCG46_RS15050 (3059070) | 3059070..3059300 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
QCG46_RS15055 (3059384) | 3059384..3059791 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
QCG46_RS15060 (3059958) | 3059958..3060113 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
QCG46_RS15065 (3060115) | 3060115..3060243 | + | 129 | WP_000344964.1 | protein YdfB | - |
QCG46_RS15070 (3060273) | 3060273..3060491 | + | 219 | WP_001171942.1 | protein YdfC | - |
QCG46_RS15075 (3061059) | 3061059..3061247 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
QCG46_RS15080 (3061244) | 3061244..3061435 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
QCG46_RS15085 (3061528) | 3061528..3062295 | + | 768 | Protein_2931 | exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 3042452..3064158 | 21706 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T276647 WP_000323025.1 NZ_CP122315:c3057083-3056796 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|