Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4000733..4001259 | Replicon | chromosome |
| Accession | NZ_CP121223 | ||
| Organism | Shigella flexneri 2a strain Sflex 21-42 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | P5F89_RS21995 | Protein ID | WP_000323025.1 |
| Coordinates | 4000972..4001259 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | P5F89_RS21990 | Protein ID | WP_000534858.1 |
| Coordinates | 4000733..4000972 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5F89_RS21970 (3998008) | 3998008..3998757 | - | 750 | Protein_3871 | fimbrial protein | - |
| P5F89_RS21975 (3998813) | 3998813..3999510 | + | 698 | WP_225620329.1 | IS1 family transposase | - |
| P5F89_RS21980 (3999528) | 3999528..4000406 | + | 879 | Protein_3873 | IS3-like element IS600 family transposase | - |
| P5F89_RS21985 (4000403) | 4000403..4000708 | - | 306 | WP_071818640.1 | hypothetical protein | - |
| P5F89_RS21990 (4000733) | 4000733..4000972 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| P5F89_RS21995 (4000972) | 4000972..4001259 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| P5F89_RS22000 (4001331) | 4001331..4001486 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| P5F89_RS22005 (4001704) | 4001704..4001955 | + | 252 | WP_000980987.1 | protein Rem | - |
| P5F89_RS22010 (4002022) | 4002022..4002300 | + | 279 | Protein_3879 | hypothetical protein | - |
| P5F89_RS22015 (4002302) | 4002302..4003351 | + | 1050 | WP_001265249.1 | DUF968 domain-containing protein | - |
| P5F89_RS22020 (4003364) | 4003364..4003720 | + | 357 | WP_000904111.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P5F89_RS22025 (4003735) | 4003735..4004556 | + | 822 | WP_000762882.1 | antitermination protein | - |
| P5F89_RS22040 (4005477) | 4005477..4005585 | + | 109 | Protein_3883 | DUF3927 family protein | - |
| P5F89_RS22045 (4005866) | 4005866..4006201 | - | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 3995395..4009398 | 14003 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T276100 WP_000323025.1 NZ_CP121223:4000972-4001259 [Shigella flexneri 2a]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|