Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 1362026..1362657 | Replicon | chromosome |
| Accession | NZ_CP121223 | ||
| Organism | Shigella flexneri 2a strain Sflex 21-42 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A822PMR8 |
| Locus tag | P5F89_RS08795 | Protein ID | WP_001259384.1 |
| Coordinates | 1362382..1362657 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | U9Y7E1 |
| Locus tag | P5F89_RS08790 | Protein ID | WP_000593555.1 |
| Coordinates | 1362026..1362385 (-) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5F89_RS08765 (1358158) | 1358158..1359102 | + | 945 | WP_000947076.1 | nickel ABC transporter permease subunit NikB | - |
| P5F89_RS08770 (1359099) | 1359099..1359932 | + | 834 | WP_001008973.1 | nickel ABC transporter permease subunit NikC | - |
| P5F89_RS08775 (1359932) | 1359932..1360696 | + | 765 | WP_001136253.1 | nickel import ATP-binding protein NikD | - |
| P5F89_RS08780 (1360693) | 1360693..1361499 | + | 807 | WP_000173660.1 | nickel import ATP-binding protein NikE | - |
| P5F89_RS08785 (1361505) | 1361505..1361906 | + | 402 | WP_001190062.1 | nickel-responsive transcriptional regulator NikR | - |
| P5F89_RS08790 (1362026) | 1362026..1362385 | - | 360 | WP_000593555.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P5F89_RS08795 (1362382) | 1362382..1362657 | - | 276 | WP_001259384.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P5F89_RS08800 (1362716) | 1362716..1363840 | - | 1125 | WP_001216257.1 | ABC transporter permease | - |
| P5F89_RS08805 (1363840) | 1363840..1366575 | - | 2736 | WP_000149170.1 | ribosome-associated ATPase/putative transporter RbbA | - |
| P5F89_RS08810 (1366572) | 1366572..1367639 | - | 1068 | WP_000361470.1 | HlyD family secretion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 1362026..1381770 | 19744 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10146.89 Da Isoelectric Point: 10.3748
>T276094 WP_001259384.1 NZ_CP121223:c1362657-1362382 [Shigella flexneri 2a]
MRTKVQALRKKQKNTLDQIFKTPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
CDWLLSIGVKP
MRTKVQALRKKQKNTLDQIFKTPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
CDWLLSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13402.27 Da Isoelectric Point: 5.1987
>AT276094 WP_000593555.1 NZ_CP121223:c1362385-1362026 [Shigella flexneri 2a]
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A822PMR8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LKZ6 |