Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1101369..1102183 | Replicon | chromosome |
Accession | NZ_CP121189 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain S1467 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A4Y6MAM1 |
Locus tag | P6164_RS05340 | Protein ID | WP_023227563.1 |
Coordinates | 1101369..1101896 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A4Y6M833 |
Locus tag | P6164_RS05345 | Protein ID | WP_072162154.1 |
Coordinates | 1101893..1102183 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6164_RS05315 (1097670) | 1097670..1098068 | + | 399 | Protein_1043 | cytoplasmic protein | - |
P6164_RS05320 (1098654) | 1098654..1099322 | + | 669 | WP_000445914.1 | hypothetical protein | - |
P6164_RS05325 (1099349) | 1099349..1099843 | + | 495 | WP_023227564.1 | hypothetical protein | - |
P6164_RS05330 (1100088) | 1100088..1100744 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
P6164_RS05335 (1101079) | 1101079..1101296 | + | 218 | Protein_1047 | IS5/IS1182 family transposase | - |
P6164_RS05340 (1101369) | 1101369..1101896 | - | 528 | WP_023227563.1 | GNAT family N-acetyltransferase | Toxin |
P6164_RS05345 (1101893) | 1101893..1102183 | - | 291 | WP_072162154.1 | DUF1778 domain-containing protein | Antitoxin |
P6164_RS05350 (1102453) | 1102453..1102631 | - | 179 | Protein_1050 | IS3 family transposase | - |
P6164_RS05355 (1102872) | 1102872..1103198 | + | 327 | WP_000393302.1 | hypothetical protein | - |
P6164_RS05360 (1103471) | 1103471..1103818 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
P6164_RS05365 (1103803) | 1103803..1104252 | - | 450 | WP_000381610.1 | membrane protein | - |
P6164_RS05370 (1104683) | 1104683..1105126 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
P6164_RS05375 (1105582) | 1105582..1106232 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1100088..1111545 | 11457 | ||
- | flank | IS/Tn | - | - | 1101156..1101296 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19099.93 Da Isoelectric Point: 9.6420
>T276016 WP_023227563.1 NZ_CP121189:c1101896-1101369 [Salmonella enterica subsp. enterica serovar Indiana]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGSVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGSVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.54 Da Isoelectric Point: 8.5779
>AT276016 WP_072162154.1 NZ_CP121189:c1102183-1101893 [Salmonella enterica subsp. enterica serovar Indiana]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y6MAM1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y6M833 |