Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1343255..1344069 | Replicon | chromosome |
Accession | NZ_CP121075 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.2574 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A5T8FHB0 |
Locus tag | P8I05_RS06470 | Protein ID | WP_023994249.1 |
Coordinates | 1343255..1343782 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | P8I05_RS06475 | Protein ID | WP_000855694.1 |
Coordinates | 1343779..1344069 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I05_RS06450 (1338556) | 1338556..1341123 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
P8I05_RS06455 (1341282) | 1341282..1341803 | + | 522 | WP_023994250.1 | hypothetical protein | - |
P8I05_RS06460 (1341974) | 1341974..1342630 | - | 657 | WP_000420451.1 | protein-serine/threonine phosphatase | - |
P8I05_RS06465 (1342965) | 1342965..1343182 | + | 218 | Protein_1252 | IS5/IS1182 family transposase | - |
P8I05_RS06470 (1343255) | 1343255..1343782 | - | 528 | WP_023994249.1 | GNAT family N-acetyltransferase | Toxin |
P8I05_RS06475 (1343779) | 1343779..1344069 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
P8I05_RS06480 (1344339) | 1344339..1344517 | - | 179 | Protein_1255 | IS3 family transposase | - |
P8I05_RS06485 (1344758) | 1344758..1345084 | + | 327 | WP_000393300.1 | hypothetical protein | - |
P8I05_RS06490 (1345357) | 1345357..1345704 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
P8I05_RS06495 (1345689) | 1345689..1346138 | - | 450 | WP_000381612.1 | membrane protein | - |
P8I05_RS06500 (1346570) | 1346570..1347013 | - | 444 | WP_023993678.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
P8I05_RS06505 (1347469) | 1347469..1348119 | + | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1343042..1353432 | 10390 | ||
- | flank | IS/Tn | - | - | 1343042..1343182 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19025.89 Da Isoelectric Point: 9.6423
>T275622 WP_023994249.1 NZ_CP121075:c1343782-1343255 [Salmonella enterica subsp. enterica serovar Infantis]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHALQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNNQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHALQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNNQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT275622 WP_000855694.1 NZ_CP121075:c1344069-1343779 [Salmonella enterica subsp. enterica serovar Infantis]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5T8FHB0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |