Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1013694..1014508 | Replicon | chromosome |
Accession | NZ_CP121068 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R21.1575 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A5T8FHB0 |
Locus tag | P8I08_RS04835 | Protein ID | WP_023994249.1 |
Coordinates | 1013694..1014221 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | P8I08_RS04840 | Protein ID | WP_000855694.1 |
Coordinates | 1014218..1014508 (-) | Length | 97 a.a. |
Genomic Context
Location: 1011721..1012242 (522 bp)
Type: Others
Protein ID: WP_023994250.1
Type: Others
Protein ID: WP_023994250.1
Location: 1013404..1013621 (218 bp)
Type: Others
Protein ID: Protein_945
Type: Others
Protein ID: Protein_945
Location: 1015197..1015523 (327 bp)
Type: Others
Protein ID: WP_000393300.1
Type: Others
Protein ID: WP_000393300.1
Location: 1017908..1018558 (651 bp)
Type: Others
Protein ID: WP_001728903.1
Type: Others
Protein ID: WP_001728903.1
Location: 1008995..1011562 (2568 bp)
Type: Others
Protein ID: WP_001005807.1
Type: Others
Protein ID: WP_001005807.1
Location: 1012413..1013069 (657 bp)
Type: Others
Protein ID: WP_000420451.1
Type: Others
Protein ID: WP_000420451.1
Location: 1013694..1014221 (528 bp)
Type: Toxin
Protein ID: WP_023994249.1
Type: Toxin
Protein ID: WP_023994249.1
Location: 1014218..1014508 (291 bp)
Type: Antitoxin
Protein ID: WP_000855694.1
Type: Antitoxin
Protein ID: WP_000855694.1
Location: 1014778..1014956 (179 bp)
Type: Others
Protein ID: Protein_948
Type: Others
Protein ID: Protein_948
Location: 1015796..1016143 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 1016128..1016577 (450 bp)
Type: Others
Protein ID: WP_000381612.1
Type: Others
Protein ID: WP_000381612.1
Location: 1017009..1017452 (444 bp)
Type: Others
Protein ID: WP_023993678.1
Type: Others
Protein ID: WP_023993678.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I08_RS04815 (1008995) | 1008995..1011562 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
P8I08_RS04820 (1011721) | 1011721..1012242 | + | 522 | WP_023994250.1 | hypothetical protein | - |
P8I08_RS04825 (1012413) | 1012413..1013069 | - | 657 | WP_000420451.1 | protein-serine/threonine phosphatase | - |
P8I08_RS04830 (1013404) | 1013404..1013621 | + | 218 | Protein_945 | IS5/IS1182 family transposase | - |
P8I08_RS04835 (1013694) | 1013694..1014221 | - | 528 | WP_023994249.1 | GNAT family N-acetyltransferase | Toxin |
P8I08_RS04840 (1014218) | 1014218..1014508 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
P8I08_RS04845 (1014778) | 1014778..1014956 | - | 179 | Protein_948 | IS3 family transposase | - |
P8I08_RS04850 (1015197) | 1015197..1015523 | + | 327 | WP_000393300.1 | hypothetical protein | - |
P8I08_RS04855 (1015796) | 1015796..1016143 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
P8I08_RS04860 (1016128) | 1016128..1016577 | - | 450 | WP_000381612.1 | membrane protein | - |
P8I08_RS04865 (1017009) | 1017009..1017452 | - | 444 | WP_023993678.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
P8I08_RS04870 (1017908) | 1017908..1018558 | + | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1013481..1023871 | 10390 | ||
- | flank | IS/Tn | - | - | 1013481..1013621 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19025.89 Da Isoelectric Point: 9.6423
>T275557 WP_023994249.1 NZ_CP121068:c1014221-1013694 [Salmonella enterica subsp. enterica serovar Infantis]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHALQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNNQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHALQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNNQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT275557 WP_000855694.1 NZ_CP121068:c1014508-1014218 [Salmonella enterica subsp. enterica serovar Infantis]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5T8FHB0 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |