Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2574255..2574626 | Replicon | chromosome |
| Accession | NZ_CP120944 | ||
| Organism | Escherichia coli O157:H7 str. EDL933 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A0D6ZRD3 |
| Locus tag | P7249_RS12945 | Protein ID | WP_001443846.1 |
| Coordinates | 2574477..2574626 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2574255..2574433 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7249_RS12915 (2570007) | 2570007..2570177 | + | 171 | WP_001625136.1 | protein YnaL | - |
| P7249_RS12920 (2570210) | 2570210..2571583 | + | 1374 | WP_000123746.1 | ATP-dependent RNA helicase DbpA | - |
| P7249_RS12925 (2571712) | 2571712..2572647 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| P7249_RS12930 (2572699) | 2572699..2573934 | - | 1236 | WP_000040839.1 | site-specific integrase | - |
| P7249_RS12935 (2573936) | 2573936..2574151 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2574255) | 2574255..2574433 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2574255) | 2574255..2574433 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2574255) | 2574255..2574433 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2574255) | 2574255..2574433 | + | 179 | NuclAT_0 | - | Antitoxin |
| P7249_RS12940 (2574251) | 2574251..2574439 | - | 189 | WP_001302840.1 | DUF1187 family protein | - |
| P7249_RS12945 (2574477) | 2574477..2574626 | - | 150 | WP_001443846.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| P7249_RS12950 (2574682) | 2574682..2575491 | - | 810 | WP_000166313.1 | recombination protein RecT | - |
| P7249_RS12955 (2575484) | 2575484..2578084 | - | 2601 | WP_000105140.1 | exodeoxyribonuclease VIII | - |
| P7249_RS12960 (2578186) | 2578186..2578461 | - | 276 | WP_001344816.1 | hypothetical protein | - |
| P7249_RS12965 (2578536) | 2578536..2578706 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| P7249_RS12970 (2578706) | 2578706..2578927 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2565440..2621851 | 56411 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5383.12 Da Isoelectric Point: 8.3398
>T275452 WP_001443846.1 NZ_CP120944:c2574626-2574477 [Escherichia coli O157:H7 str. EDL933]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
Download Length: 150 bp
Antitoxin
Download Length: 179 bp
>AT275452 NZ_CP120944:2574255-2574433 [Escherichia coli O157:H7 str. EDL933]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|