Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 1587928..1588148 | Replicon | chromosome |
| Accession | NZ_CP117957 | ||
| Organism | Clostridioides difficile strain P4D3A1-1 | ||
Toxin (Protein)
| Gene name | CD0956.2 | Uniprot ID | Q183Z5 |
| Locus tag | PT260_RS07235 | Protein ID | WP_003429855.1 |
| Coordinates | 1587928..1588089 (+) | Length | 54 a.a. |
Antitoxin (RNA)
| Gene name | RCd10 | ||
| Locus tag | - | ||
| Coordinates | 1588009..1588148 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT260_RS07205 (1583785) | 1583785..1584222 | + | 438 | WP_009888839.1 | hypothetical protein | - |
| PT260_RS07210 (1584215) | 1584215..1584391 | + | 177 | WP_009888840.1 | hypothetical protein | - |
| PT260_RS07215 (1584392) | 1584392..1585702 | + | 1311 | WP_009893136.1 | phage tail sheath family protein | - |
| PT260_RS07220 (1585719) | 1585719..1586189 | + | 471 | WP_009888842.1 | phage tail tube protein | - |
| PT260_RS07225 (1586248) | 1586248..1587075 | + | 828 | WP_009888843.1 | hypothetical protein | - |
| PT260_RS07230 (1587147) | 1587147..1587587 | + | 441 | WP_003429853.1 | phage portal protein | - |
| PT260_RS07235 (1587928) | 1587928..1588089 | + | 162 | WP_003429855.1 | hypothetical protein | Toxin |
| - (1588009) | 1588009..1588148 | - | 140 | NuclAT_1 | - | Antitoxin |
| - (1588009) | 1588009..1588148 | - | 140 | NuclAT_1 | - | Antitoxin |
| - (1588009) | 1588009..1588148 | - | 140 | NuclAT_2 | - | Antitoxin |
| - (1588493) | 1588493..1588541 | - | 49 | NuclAT_3 | - | - |
| - (1588493) | 1588493..1588541 | - | 49 | NuclAT_4 | - | - |
| - (1588493) | 1588493..1588541 | - | 49 | NuclAT_5 | - | - |
| PT260_RS07240 (1589426) | 1589426..1589614 | + | 189 | WP_003429858.1 | hypothetical protein | - |
| PT260_RS07245 (1589733) | 1589733..1590599 | + | 867 | WP_009888845.1 | BRO family protein | - |
| PT260_RS07250 (1590652) | 1590652..1590786 | + | 135 | WP_009888846.1 | hypothetical protein | - |
| PT260_RS07255 (1591464) | 1591464..1591991 | + | 528 | WP_009888847.1 | DUF4352 domain-containing protein | - |
| PT260_RS07260 (1592129) | 1592129..1592896 | + | 768 | WP_009888848.1 | DUF4428 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T272477 WP_003429855.1 NZ_CP117957:1587928-1588089 [Clostridioides difficile]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
Antitoxin
Download Length: 140 bp
>AT272477 NZ_CP117957:c1588148-1588009 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
