Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) CD-RCd/-
Location 1587928..1588148 Replicon chromosome
Accession NZ_CP117957
Organism Clostridioides difficile strain P4D3A1-1

Toxin (Protein)


Gene name CD0956.2 Uniprot ID Q183Z5
Locus tag PT260_RS07235 Protein ID WP_003429855.1
Coordinates 1587928..1588089 (+) Length 54 a.a.

Antitoxin (RNA)


Gene name RCd10
Locus tag -
Coordinates 1588009..1588148 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT260_RS07205 (1583785) 1583785..1584222 + 438 WP_009888839.1 hypothetical protein -
PT260_RS07210 (1584215) 1584215..1584391 + 177 WP_009888840.1 hypothetical protein -
PT260_RS07215 (1584392) 1584392..1585702 + 1311 WP_009893136.1 phage tail sheath family protein -
PT260_RS07220 (1585719) 1585719..1586189 + 471 WP_009888842.1 phage tail tube protein -
PT260_RS07225 (1586248) 1586248..1587075 + 828 WP_009888843.1 hypothetical protein -
PT260_RS07230 (1587147) 1587147..1587587 + 441 WP_003429853.1 phage portal protein -
PT260_RS07235 (1587928) 1587928..1588089 + 162 WP_003429855.1 hypothetical protein Toxin
- (1588009) 1588009..1588148 - 140 NuclAT_1 - Antitoxin
- (1588009) 1588009..1588148 - 140 NuclAT_1 - Antitoxin
- (1588009) 1588009..1588148 - 140 NuclAT_2 - Antitoxin
- (1588493) 1588493..1588541 - 49 NuclAT_3 - -
- (1588493) 1588493..1588541 - 49 NuclAT_4 - -
- (1588493) 1588493..1588541 - 49 NuclAT_5 - -
PT260_RS07240 (1589426) 1589426..1589614 + 189 WP_003429858.1 hypothetical protein -
PT260_RS07245 (1589733) 1589733..1590599 + 867 WP_009888845.1 BRO family protein -
PT260_RS07250 (1590652) 1590652..1590786 + 135 WP_009888846.1 hypothetical protein -
PT260_RS07255 (1591464) 1591464..1591991 + 528 WP_009888847.1 DUF4352 domain-containing protein -
PT260_RS07260 (1592129) 1592129..1592896 + 768 WP_009888848.1 DUF4428 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 54 a.a.        Molecular weight: 6120.42 Da        Isoelectric Point: 10.8938

>T272477 WP_003429855.1 NZ_CP117957:1587928-1588089 [Clostridioides difficile]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK

Download         Length: 162 bp

Antitoxin


Download         Length: 140 bp

>AT272477 NZ_CP117957:c1588148-1588009 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A069AVN2

Antitoxin

Download structure file

References