Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | IasE-IsrA/SymE(toxin) |
Location | 4515259..4515465 | Replicon | chromosome |
Accession | NZ_CP117852 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R |
Toxin (Protein)
Gene name | IasE | Uniprot ID | A0A3Y1TUH5 |
Locus tag | PTZ66_RS22115 | Protein ID | WP_026080916.1 |
Coordinates | 4515259..4515465 (+) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | IsrA | ||
Locus tag | - | ||
Coordinates | 4515270..4515455 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ66_RS22080 | 4510386..4510631 | + | 246 | WP_026080917.1 | SymE family type I addiction module toxin | - |
PTZ66_RS22085 | 4510684..4511166 | - | 483 | WP_017442170.1 | immunity 26/phosphotriesterase HocA family protein | - |
PTZ66_RS22090 | 4511685..4512131 | - | 447 | WP_000935097.1 | protein SciX | - |
PTZ66_RS22095 | 4512125..4513093 | - | 969 | Protein_4307 | polymorphic toxin type 47 domain-containing protein | - |
PTZ66_RS22100 | 4513519..4513653 | + | 135 | Protein_4308 | SymE family type I addiction module toxin | - |
PTZ66_RS22105 | 4513722..4514009 | - | 288 | WP_017442165.1 | hypothetical protein | - |
PTZ66_RS22110 | 4514012..4515265 | - | 1254 | Protein_4310 | RHS domain-containing protein | - |
PTZ66_RS22115 | 4515259..4515465 | + | 207 | WP_026080916.1 | SymE family type I addiction module toxin | Toxin |
- | 4515270..4515455 | - | 186 | - | - | Antitoxin |
PTZ66_RS22120 | 4515512..4515790 | - | 279 | WP_017442162.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4493625..4537995 | 44370 | |
- | inside | Genomic island | - | - | 4495308..4511166 | 15858 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7592.80 Da Isoelectric Point: 6.4569
>T272409 WP_026080916.1 NZ_CP117852:4515259-4515465 [Salmonella enterica subsp. enterica serovar Mbandaka]
IPELHLKGDWLAEAGFETGTSVTVKISEGCLILIAETDEVRDLRKELYLVKKSMKHIKAGVNNVVNRD
IPELHLKGDWLAEAGFETGTSVTVKISEGCLILIAETDEVRDLRKELYLVKKSMKHIKAGVNNVVNRD
Download Length: 207 bp
Antitoxin
Download Length: 186 bp
>AT272409 NZ_CP117852:c4515455-4515270 [Salmonella enterica subsp. enterica serovar Mbandaka]
TTCACCACATTATTTACCCCCGCCTTAATATGCTTCATCGACTTTTTCACCAGATAAAGCTCCTTCCGTAGATCCCTCAC
TTCGTCCGTCTCTGCAATCAGGATCAAACACCCCTCCGAGATCTTCACGGTTACGCTCGTCCCGGTCTCAAATCCCGCCT
CGGCCAGCCAGTCGCCCTTAAGATGC
TTCACCACATTATTTACCCCCGCCTTAATATGCTTCATCGACTTTTTCACCAGATAAAGCTCCTTCCGTAGATCCCTCAC
TTCGTCCGTCTCTGCAATCAGGATCAAACACCCCTCCGAGATCTTCACGGTTACGCTCGTCCCGGTCTCAAATCCCGCCT
CGGCCAGCCAGTCGCCCTTAAGATGC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|