Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 1838973..1839562 | Replicon | chromosome |
Accession | NZ_CP117554 | ||
Organism | Erwinia amylovora strain 99east-3-1 |
Toxin (Protein)
Gene name | doc | Uniprot ID | D4I2L7 |
Locus tag | PTC76_RS08575 | Protein ID | WP_004157545.1 |
Coordinates | 1839191..1839562 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | D4I2L6 |
Locus tag | PTC76_RS08570 | Protein ID | WP_004157544.1 |
Coordinates | 1838973..1839194 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC76_RS08550 (PTC76_08550) | 1834950..1835159 | + | 210 | WP_004157539.1 | glycine zipper 2TM domain-containing protein | - |
PTC76_RS08555 (PTC76_08555) | 1835272..1835748 | + | 477 | WP_004157540.1 | GNAT family N-acetyltransferase | - |
PTC76_RS08560 (PTC76_08560) | 1835872..1836621 | + | 750 | WP_004157541.1 | 5'-nucleotidase, lipoprotein e(P4) family | - |
PTC76_RS08565 (PTC76_08565) | 1836708..1838180 | - | 1473 | WP_004157542.1 | catalase | - |
PTC76_RS08570 (PTC76_08570) | 1838973..1839194 | + | 222 | WP_004157544.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PTC76_RS08575 (PTC76_08575) | 1839191..1839562 | + | 372 | WP_004157545.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PTC76_RS08580 (PTC76_08580) | 1840446..1842386 | + | 1941 | WP_004157559.1 | methyl-accepting chemotaxis protein | - |
PTC76_RS08585 (PTC76_08585) | 1842512..1843147 | + | 636 | WP_004157562.1 | carbonic anhydrase | - |
PTC76_RS08590 (PTC76_08590) | 1843232..1843681 | - | 450 | WP_004157563.1 | DUF4385 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1824237..1842386 | 18149 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13667.70 Da Isoelectric Point: 7.4182
>T271325 WP_004157545.1 NZ_CP117554:1839191-1839562 [Erwinia amylovora]
MIYFLSSQDIIGIHQRMIVAYGGLAGYADPGRIESMATRILNRHIYEGEDDIYILAAAYLLAIARGHCFNDANKRTAFAS
TALFLRRNGILLRFSPIHEQLTVSAAQGSLDVWHIAEALKQST
MIYFLSSQDIIGIHQRMIVAYGGLAGYADPGRIESMATRILNRHIYEGEDDIYILAAAYLLAIARGHCFNDANKRTAFAS
TALFLRRNGILLRFSPIHEQLTVSAAQGSLDVWHIAEALKQST
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | D4I2L7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A831A2K1 |