Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 990719..991533 | Replicon | chromosome |
| Accession | NZ_CP117396 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM016 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | - |
| Locus tag | PQP86_RS04810 | Protein ID | WP_000971658.1 |
| Coordinates | 990719..991246 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | PQP86_RS04815 | Protein ID | WP_000855694.1 |
| Coordinates | 991243..991533 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP86_RS04780 (986930) | 986930..987327 | + | 398 | Protein_935 | cytoplasmic protein | - |
| PQP86_RS04785 (987518) | 987518..987706 | + | 189 | Protein_936 | hypothetical protein | - |
| PQP86_RS04790 (987914) | 987914..988582 | + | 669 | WP_000445914.1 | hypothetical protein | - |
| PQP86_RS04795 (988609) | 988609..989103 | + | 495 | WP_000424948.1 | hypothetical protein | - |
| PQP86_RS04800 (989348) | 989348..990004 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| PQP86_RS04805 (990237) | 990237..990646 | + | 410 | Protein_940 | IS5/IS1182 family transposase | - |
| PQP86_RS04810 (990719) | 990719..991246 | - | 528 | WP_000971658.1 | GNAT family N-acetyltransferase | Toxin |
| PQP86_RS04815 (991243) | 991243..991533 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| PQP86_RS04820 (991803) | 991803..992003 | - | 201 | Protein_943 | IS3 family transposase | - |
| PQP86_RS04825 (992244) | 992244..992570 | + | 327 | WP_000393305.1 | hypothetical protein | - |
| PQP86_RS04830 (992843) | 992843..993190 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
| PQP86_RS04835 (993175) | 993175..993624 | - | 450 | WP_000381612.1 | membrane protein | - |
| PQP86_RS04840 (994056) | 994056..994499 | - | 444 | WP_079798511.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| PQP86_RS04845 (994955) | 994955..995605 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 990506..1000918 | 10412 | ||
| - | flank | IS/Tn | - | - | 990506..990646 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19051.87 Da Isoelectric Point: 9.6420
>T271118 WP_000971658.1 NZ_CP117396:c991246-990719 [Salmonella enterica subsp. enterica serovar Uganda]
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT271118 WP_000855694.1 NZ_CP117396:c991533-991243 [Salmonella enterica subsp. enterica serovar Uganda]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|