Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 990788..991602 | Replicon | chromosome |
| Accession | NZ_CP117390 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM008 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | - |
| Locus tag | PQP88_RS04810 | Protein ID | WP_000971658.1 |
| Coordinates | 990788..991315 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | PQP88_RS04815 | Protein ID | WP_000855694.1 |
| Coordinates | 991312..991602 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP88_RS04780 (986999) | 986999..987396 | + | 398 | Protein_935 | cytoplasmic protein | - |
| PQP88_RS04785 (987587) | 987587..987775 | + | 189 | Protein_936 | hypothetical protein | - |
| PQP88_RS04790 (987983) | 987983..988651 | + | 669 | WP_000445914.1 | hypothetical protein | - |
| PQP88_RS04795 (988678) | 988678..989172 | + | 495 | WP_000424948.1 | hypothetical protein | - |
| PQP88_RS04800 (989417) | 989417..990073 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| PQP88_RS04805 (990306) | 990306..990715 | + | 410 | Protein_940 | IS5/IS1182 family transposase | - |
| PQP88_RS04810 (990788) | 990788..991315 | - | 528 | WP_000971658.1 | GNAT family N-acetyltransferase | Toxin |
| PQP88_RS04815 (991312) | 991312..991602 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| PQP88_RS04820 (991872) | 991872..992072 | - | 201 | Protein_943 | IS3 family transposase | - |
| PQP88_RS04825 (992313) | 992313..992639 | + | 327 | WP_000393305.1 | hypothetical protein | - |
| PQP88_RS04830 (992912) | 992912..993259 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
| PQP88_RS04835 (993244) | 993244..993693 | - | 450 | WP_000381612.1 | membrane protein | - |
| PQP88_RS04840 (994125) | 994125..994568 | - | 444 | WP_079798511.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| PQP88_RS04845 (995024) | 995024..995674 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 990575..1000987 | 10412 | ||
| - | flank | IS/Tn | - | - | 990575..990715 | 140 | |
| - | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 989417..1000987 | 11570 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19051.87 Da Isoelectric Point: 9.6420
>T271061 WP_000971658.1 NZ_CP117390:c991315-990788 [Salmonella enterica subsp. enterica serovar Uganda]
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT271061 WP_000855694.1 NZ_CP117390:c991602-991312 [Salmonella enterica subsp. enterica serovar Uganda]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|