Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | IasE-IsrA/SymE(toxin) |
Location | 3687985..3688335 | Replicon | chromosome |
Accession | NZ_CP117386 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM011 |
Toxin (Protein)
Gene name | IasE | Uniprot ID | A0A3X9ZUV0 |
Locus tag | PQP90_RS18265 | Protein ID | WP_000994229.1 |
Coordinates | 3688078..3688335 (+) | Length | 86 a.a. |
Antitoxin (RNA)
Gene name | IsrA | ||
Locus tag | - | ||
Coordinates | 3687985..3688253 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP90_RS18225 | 3683025..3683729 | - | 705 | Protein_3565 | integrase core domain-containing protein | - |
PQP90_RS18230 | 3683782..3684030 | + | 249 | WP_001738030.1 | SymE family type I addiction module toxin | - |
PQP90_RS18235 | 3684162..3684440 | - | 279 | WP_079798501.1 | hypothetical protein | - |
PQP90_RS18240 | 3684523..3684639 | - | 117 | WP_227457392.1 | hypothetical protein | - |
PQP90_RS18245 | 3684881..3685138 | + | 258 | WP_079798500.1 | SymE family type I addiction module toxin | - |
PQP90_RS18250 | 3685229..3685606 | - | 378 | WP_000739707.1 | Imm8 family immunity protein | - |
PQP90_RS18255 | 3686339..3686704 | - | 366 | WP_001231281.1 | hypothetical protein | - |
PQP90_RS18260 | 3686670..3688016 | - | 1347 | Protein_3572 | RHS repeat-associated core domain-containing protein | - |
- | 3687985..3688253 | - | 269 | - | - | Antitoxin |
PQP90_RS18265 | 3688078..3688335 | + | 258 | WP_000994229.1 | SymE family type I addiction module toxin | Toxin |
PQP90_RS18270 | 3688399..3688737 | - | 339 | WP_000382983.1 | hypothetical protein | - |
PQP90_RS18275 | 3689108..3690148 | - | 1041 | Protein_3575 | RHS repeat-associated core domain-containing protein | - |
PQP90_RS18280 | 3690210..3690467 | + | 258 | WP_000994229.1 | SymE family type I addiction module toxin | - |
PQP90_RS18285 | 3690531..3690869 | - | 339 | WP_000382983.1 | hypothetical protein | - |
PQP90_RS18290 | 3691240..3692997 | - | 1758 | Protein_3578 | RHS repeat domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3664537..3693878 | 29341 | |
- | flank | IS/Tn | - | - | 3683025..3683306 | 281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9538.91 Da Isoelectric Point: 7.2759
>T271027 WP_000994229.1 NZ_CP117386:3688078-3688335 [Salmonella enterica subsp. enterica serovar Uganda]
MNASGVSVRHINSKTHMTTYYSQIPSLHLKGDWLEEAGFETGRGVTVKISQGCIVLMADSNEEQKLREQLYKAEQVVKGM
RDVIV
MNASGVSVRHINSKTHMTTYYSQIPSLHLKGDWLEEAGFETGRGVTVKISQGCIVLMADSNEEQKLREQLYKAEQVVKGM
RDVIV
Download Length: 258 bp
Antitoxin
Download Length: 269 bp
>AT271027 NZ_CP117386:c3688253-3687985 [Salmonella enterica subsp. enterica serovar Uganda]
TCCGCCATCAGCACAATACACCCCTGTGAAATCTTCACGGTCACGCCGCGCCCGGTCTCAAATCCCGCTTCTTCCAGCCA
GTCACCCTTAAGGTGCAGGCTGGGGATTTGTGAGTAATAGGTGGTCATGTGGGTTTTGCTGTTGATGTGGCGGACGCTGA
CGCCGGAGGCATTCATATTTGCTGACTAAATAAATTCTTAATTATCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTG
AGCGAGTATGAGCGCGACAGCCTGCACCG
TCCGCCATCAGCACAATACACCCCTGTGAAATCTTCACGGTCACGCCGCGCCCGGTCTCAAATCCCGCTTCTTCCAGCCA
GTCACCCTTAAGGTGCAGGCTGGGGATTTGTGAGTAATAGGTGGTCATGTGGGTTTTGCTGTTGATGTGGCGGACGCTGA
CGCCGGAGGCATTCATATTTGCTGACTAAATAAATTCTTAATTATCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTG
AGCGAGTATGAGCGCGACAGCCTGCACCG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|