Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 990718..991532 | Replicon | chromosome |
| Accession | NZ_CP117386 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM011 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | - |
| Locus tag | PQP90_RS04815 | Protein ID | WP_000971658.1 |
| Coordinates | 990718..991245 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | PQP90_RS04820 | Protein ID | WP_000855694.1 |
| Coordinates | 991242..991532 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP90_RS04785 (986929) | 986929..987326 | + | 398 | Protein_936 | cytoplasmic protein | - |
| PQP90_RS04790 (987517) | 987517..987705 | + | 189 | Protein_937 | hypothetical protein | - |
| PQP90_RS04795 (987913) | 987913..988581 | + | 669 | WP_000445914.1 | hypothetical protein | - |
| PQP90_RS04800 (988608) | 988608..989102 | + | 495 | WP_000424948.1 | hypothetical protein | - |
| PQP90_RS04805 (989347) | 989347..990003 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| PQP90_RS04810 (990236) | 990236..990645 | + | 410 | Protein_941 | IS5/IS1182 family transposase | - |
| PQP90_RS04815 (990718) | 990718..991245 | - | 528 | WP_000971658.1 | GNAT family N-acetyltransferase | Toxin |
| PQP90_RS04820 (991242) | 991242..991532 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| PQP90_RS04825 (991802) | 991802..992002 | - | 201 | Protein_944 | IS3 family transposase | - |
| PQP90_RS04830 (992243) | 992243..992569 | + | 327 | WP_000393305.1 | hypothetical protein | - |
| PQP90_RS04835 (992842) | 992842..993189 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
| PQP90_RS04840 (993174) | 993174..993623 | - | 450 | WP_000381612.1 | membrane protein | - |
| PQP90_RS04845 (994055) | 994055..994498 | - | 444 | WP_079798511.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| PQP90_RS04850 (994954) | 994954..995604 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 990505..1000917 | 10412 | ||
| - | flank | IS/Tn | - | - | 990505..990645 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19051.87 Da Isoelectric Point: 9.6420
>T271017 WP_000971658.1 NZ_CP117386:c991245-990718 [Salmonella enterica subsp. enterica serovar Uganda]
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT271017 WP_000855694.1 NZ_CP117386:c991532-991242 [Salmonella enterica subsp. enterica serovar Uganda]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|