Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 990873..991687 | Replicon | chromosome |
Accession | NZ_CP117384 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM013 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | - |
Locus tag | PQP89_RS04810 | Protein ID | WP_000971658.1 |
Coordinates | 990873..991400 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | PQP89_RS04815 | Protein ID | WP_000855694.1 |
Coordinates | 991397..991687 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP89_RS04780 (987084) | 987084..987481 | + | 398 | Protein_935 | cytoplasmic protein | - |
PQP89_RS04785 (987672) | 987672..987860 | + | 189 | Protein_936 | hypothetical protein | - |
PQP89_RS04790 (988068) | 988068..988736 | + | 669 | WP_000445914.1 | hypothetical protein | - |
PQP89_RS04795 (988763) | 988763..989257 | + | 495 | WP_000424948.1 | hypothetical protein | - |
PQP89_RS04800 (989502) | 989502..990158 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
PQP89_RS04805 (990391) | 990391..990800 | + | 410 | Protein_940 | IS5/IS1182 family transposase | - |
PQP89_RS04810 (990873) | 990873..991400 | - | 528 | WP_000971658.1 | GNAT family N-acetyltransferase | Toxin |
PQP89_RS04815 (991397) | 991397..991687 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
PQP89_RS04820 (991957) | 991957..992157 | - | 201 | Protein_943 | IS3 family transposase | - |
PQP89_RS04825 (992398) | 992398..992724 | + | 327 | WP_000393305.1 | hypothetical protein | - |
PQP89_RS04830 (992997) | 992997..993344 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
PQP89_RS04835 (993329) | 993329..993778 | - | 450 | WP_000381612.1 | membrane protein | - |
PQP89_RS04840 (994210) | 994210..994653 | - | 444 | WP_079798511.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PQP89_RS04845 (995109) | 995109..995759 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 990660..1001072 | 10412 | ||
- | flank | IS/Tn | - | - | 990660..990800 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19051.87 Da Isoelectric Point: 9.6420
>T270995 WP_000971658.1 NZ_CP117384:c991400-990873 [Salmonella enterica subsp. enterica serovar Uganda]
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT270995 WP_000855694.1 NZ_CP117384:c991687-991397 [Salmonella enterica subsp. enterica serovar Uganda]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|