Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | IasE-IsrA/SymE(toxin) |
Location | 3688253..3688603 | Replicon | chromosome |
Accession | NZ_CP117382 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM018 |
Toxin (Protein)
Gene name | IasE | Uniprot ID | A0A3X9ZUV0 |
Locus tag | PQP98_RS18240 | Protein ID | WP_000994229.1 |
Coordinates | 3688346..3688603 (+) | Length | 86 a.a. |
Antitoxin (RNA)
Gene name | IsrA | ||
Locus tag | - | ||
Coordinates | 3688253..3688521 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP98_RS18200 | 3683293..3683997 | - | 705 | Protein_3560 | integrase core domain-containing protein | - |
PQP98_RS18205 | 3684050..3684298 | + | 249 | WP_001738030.1 | SymE family type I addiction module toxin | - |
PQP98_RS18210 | 3684430..3684708 | - | 279 | WP_079798501.1 | hypothetical protein | - |
PQP98_RS18215 | 3684791..3684907 | - | 117 | WP_227457392.1 | hypothetical protein | - |
PQP98_RS18220 | 3685149..3685406 | + | 258 | WP_079798500.1 | SymE family type I addiction module toxin | - |
PQP98_RS18225 | 3685497..3685874 | - | 378 | WP_000739707.1 | Imm8 family immunity protein | - |
PQP98_RS18230 | 3686607..3686972 | - | 366 | WP_001231281.1 | hypothetical protein | - |
PQP98_RS18235 | 3686938..3688284 | - | 1347 | Protein_3567 | RHS repeat-associated core domain-containing protein | - |
- | 3688253..3688521 | - | 269 | - | - | Antitoxin |
PQP98_RS18240 | 3688346..3688603 | + | 258 | WP_000994229.1 | SymE family type I addiction module toxin | Toxin |
PQP98_RS18245 | 3688667..3689005 | - | 339 | WP_000382983.1 | hypothetical protein | - |
PQP98_RS18250 | 3689376..3690416 | - | 1041 | Protein_3570 | RHS repeat-associated core domain-containing protein | - |
PQP98_RS18255 | 3690478..3690735 | + | 258 | WP_000994229.1 | SymE family type I addiction module toxin | - |
PQP98_RS18260 | 3690799..3691137 | - | 339 | WP_000382983.1 | hypothetical protein | - |
PQP98_RS18265 | 3691508..3693265 | - | 1758 | Protein_3573 | RHS repeat domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3664805..3694146 | 29341 | |
- | flank | IS/Tn | - | - | 3683293..3683574 | 281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9538.91 Da Isoelectric Point: 7.2759
>T270983 WP_000994229.1 NZ_CP117382:3688346-3688603 [Salmonella enterica subsp. enterica serovar Uganda]
MNASGVSVRHINSKTHMTTYYSQIPSLHLKGDWLEEAGFETGRGVTVKISQGCIVLMADSNEEQKLREQLYKAEQVVKGM
RDVIV
MNASGVSVRHINSKTHMTTYYSQIPSLHLKGDWLEEAGFETGRGVTVKISQGCIVLMADSNEEQKLREQLYKAEQVVKGM
RDVIV
Download Length: 258 bp
Antitoxin
Download Length: 269 bp
>AT270983 NZ_CP117382:c3688521-3688253 [Salmonella enterica subsp. enterica serovar Uganda]
TCCGCCATCAGCACAATACACCCCTGTGAAATCTTCACGGTCACGCCGCGCCCGGTCTCAAATCCCGCTTCTTCCAGCCA
GTCACCCTTAAGGTGCAGGCTGGGGATTTGTGAGTAATAGGTGGTCATGTGGGTTTTGCTGTTGATGTGGCGGACGCTGA
CGCCGGAGGCATTCATATTTGCTGACTAAATAAATTCTTAATTATCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTG
AGCGAGTATGAGCGCGACAGCCTGCACCG
TCCGCCATCAGCACAATACACCCCTGTGAAATCTTCACGGTCACGCCGCGCCCGGTCTCAAATCCCGCTTCTTCCAGCCA
GTCACCCTTAAGGTGCAGGCTGGGGATTTGTGAGTAATAGGTGGTCATGTGGGTTTTGCTGTTGATGTGGCGGACGCTGA
CGCCGGAGGCATTCATATTTGCTGACTAAATAAATTCTTAATTATCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTG
AGCGAGTATGAGCGCGACAGCCTGCACCG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|