Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 990564..991378 | Replicon | chromosome |
| Accession | NZ_CP117382 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM018 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | - |
| Locus tag | PQP98_RS04805 | Protein ID | WP_000971658.1 |
| Coordinates | 990564..991091 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | PQP98_RS04810 | Protein ID | WP_000855694.1 |
| Coordinates | 991088..991378 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP98_RS04775 (986775) | 986775..987172 | + | 398 | Protein_934 | cytoplasmic protein | - |
| PQP98_RS04780 (987363) | 987363..987551 | + | 189 | Protein_935 | hypothetical protein | - |
| PQP98_RS04785 (987759) | 987759..988427 | + | 669 | WP_000445914.1 | hypothetical protein | - |
| PQP98_RS04790 (988454) | 988454..988948 | + | 495 | WP_000424948.1 | hypothetical protein | - |
| PQP98_RS04795 (989193) | 989193..989849 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| PQP98_RS04800 (990082) | 990082..990491 | + | 410 | Protein_939 | IS5/IS1182 family transposase | - |
| PQP98_RS04805 (990564) | 990564..991091 | - | 528 | WP_000971658.1 | GNAT family N-acetyltransferase | Toxin |
| PQP98_RS04810 (991088) | 991088..991378 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| PQP98_RS04815 (991648) | 991648..991848 | - | 201 | Protein_942 | IS3 family transposase | - |
| PQP98_RS04820 (992089) | 992089..992415 | + | 327 | WP_000393305.1 | hypothetical protein | - |
| PQP98_RS04825 (992688) | 992688..993035 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
| PQP98_RS04830 (993020) | 993020..993469 | - | 450 | WP_000381612.1 | membrane protein | - |
| PQP98_RS04835 (993901) | 993901..994344 | - | 444 | WP_079798511.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| PQP98_RS04840 (994800) | 994800..995450 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 990351..1000763 | 10412 | ||
| - | flank | IS/Tn | - | - | 990351..990491 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19051.87 Da Isoelectric Point: 9.6420
>T270973 WP_000971658.1 NZ_CP117382:c991091-990564 [Salmonella enterica subsp. enterica serovar Uganda]
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT270973 WP_000855694.1 NZ_CP117382:c991378-991088 [Salmonella enterica subsp. enterica serovar Uganda]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|