Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | IasE-IsrA/- |
Location | 1442511..1442913 | Replicon | chromosome |
Accession | NZ_CP117299 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM-F22S |
Toxin (Protein)
Gene name | IasE | Uniprot ID | A0A418Z3G0 |
Locus tag | PH350_RS06955 | Protein ID | WP_017442176.1 |
Coordinates | 1442511..1442756 (-) | Length | 82 a.a. |
Antitoxin (RNA)
Gene name | IsrA | ||
Locus tag | - | ||
Coordinates | 1442606..1442913 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH350_RS06905 | 1438219..1438701 | + | 483 | WP_017442170.1 | immunity 26/phosphotriesterase HocA family protein | - |
PH350_RS06910 | 1438754..1438981 | - | 228 | WP_017442171.1 | SymE family type I addiction module toxin | - |
PH350_RS06915 | 1439164..1439280 | + | 117 | Protein_1338 | RHS repeat-associated core domain-containing protein | - |
PH350_RS06920 | 1439395..1439676 | + | 282 | WP_176132412.1 | hypothetical protein | - |
PH350_RS06925 | 1439673..1440119 | + | 447 | WP_017442172.1 | hypothetical protein | - |
PH350_RS06930 | 1440478..1440630 | + | 153 | WP_223195354.1 | hypothetical protein | - |
PH350_RS06935 | 1440651..1440929 | + | 279 | WP_197398372.1 | hypothetical protein | - |
PH350_RS06940 | 1440931..1441509 | + | 579 | WP_017442174.1 | hypothetical protein | - |
PH350_RS06945 | 1441714..1442091 | + | 378 | WP_223195355.1 | HNH endonuclease | - |
PH350_RS06950 | 1442088..1442444 | + | 357 | WP_017442175.1 | hypothetical protein | - |
PH350_RS06955 | 1442511..1442756 | - | 246 | WP_017442176.1 | hypothetical protein | Toxin |
- | 1442606..1442913 | + | 308 | - | - | Antitoxin |
PH350_RS06960 | 1443090..1443383 | + | 294 | WP_129369132.1 | hypothetical protein | - |
PH350_RS06965 | 1443833..1444204 | + | 372 | WP_223195353.1 | hypothetical protein | - |
PH350_RS06970 | 1444201..1444668 | + | 468 | WP_017442178.1 | hypothetical protein | - |
PH350_RS06975 | 1444986..1445264 | + | 279 | WP_077907264.1 | hypothetical protein | - |
PH350_RS06980 | 1445331..1445645 | - | 315 | WP_072103451.1 | SymE family type I addiction module toxin | - |
PH350_RS06985 | 1445698..1445856 | + | 159 | Protein_1352 | transposase | - |
PH350_RS06990 | 1445924..1446481 | - | 558 | Protein_1353 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1412880..1456498 | 43618 | |
- | flank | IS/Tn | - | - | 1445924..1446301 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 82 a.a. Molecular weight: 8761.95 Da Isoelectric Point: 4.3010
>T270385 WP_017442176.1 NZ_CP117299:c1442756-1442511 [Salmonella enterica subsp. enterica serovar Mbandaka]
MNASGASVRHINSETCMTACYSQIPSGDCQEEAGFETGRSVTVKISDGCIVLMADGNEVQKLCEQLYKAEQVVKGMWDVI
V
MNASGASVRHINSETCMTACYSQIPSGDCQEEAGFETGRSVTVKISDGCIVLMADGNEVQKLCEQLYKAEQVVKGMWDVI
V
Download Length: 246 bp
Antitoxin
Download Length: 308 bp
>AT270385 NZ_CP117299:1442606-1442913 [Salmonella enterica subsp. enterica serovar Mbandaka]
CAATACACCCGTCCGAAATCTTCACCGTCACGCTGCGCCCGGTCTCAAATCCCGCTTCTTCCTGGCAGTCGCCGCTGGGG
ATTTGTGAGTAACAGGCGGTCATGCAGGTTTCGCTGTTGATGTGGCGGACGCTGGCGCCGGAGGCATTCATATTTGCTGA
CTAAATAAATTCTTAATTCTCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTGAGCGAGTATGGGCGCGACATCATGG
CACCGCGCCTCCCTCTCCCCGGCCAGCACCGGGCGGTGATGAGCAACCGGCTGCCGGGGCCGTATTTT
CAATACACCCGTCCGAAATCTTCACCGTCACGCTGCGCCCGGTCTCAAATCCCGCTTCTTCCTGGCAGTCGCCGCTGGGG
ATTTGTGAGTAACAGGCGGTCATGCAGGTTTCGCTGTTGATGTGGCGGACGCTGGCGCCGGAGGCATTCATATTTGCTGA
CTAAATAAATTCTTAATTCTCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTGAGCGAGTATGGGCGCGACATCATGG
CACCGCGCCTCCCTCTCCCCGGCCAGCACCGGGCGGTGATGAGCAACCGGCTGCCGGGGCCGTATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|