Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 322763..323554 | Replicon | chromosome |
| Accession | NZ_CP117242 | ||
| Organism | Staphylococcus aureus strain ATCC 14458 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A380E6V7 |
| Locus tag | PQQ25_RS01730 | Protein ID | WP_000525007.1 |
| Coordinates | 322763..323227 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | PQQ25_RS01735 | Protein ID | WP_000333630.1 |
| Coordinates | 323240..323554 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ25_RS01710 (318299) | 318299..320230 | + | 1932 | Protein_281 | YSIRK domain-containing triacylglycerol lipase Lip2/Geh | - |
| PQQ25_RS01715 (320324) | 320324..321529 | - | 1206 | WP_000264186.1 | tyrosine-type recombinase/integrase | - |
| PQQ25_RS01720 (321640) | 321640..321819 | + | 180 | WP_000337827.1 | hypothetical protein | - |
| PQQ25_RS01725 (321799) | 321799..322731 | - | 933 | WP_000392183.1 | hypothetical protein | - |
| PQQ25_RS01730 (322763) | 322763..323227 | - | 465 | WP_000525007.1 | hypothetical protein | Toxin |
| PQQ25_RS01735 (323240) | 323240..323554 | - | 315 | WP_000333630.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PQQ25_RS01740 (323706) | 323706..323942 | + | 237 | WP_001121116.1 | helix-turn-helix transcriptional regulator | - |
| PQQ25_RS01745 (323956) | 323956..324135 | + | 180 | WP_000438352.1 | hypothetical protein | - |
| PQQ25_RS01750 (324236) | 324236..324718 | - | 483 | WP_000394410.1 | hypothetical protein | - |
| PQQ25_RS01755 (324778) | 324778..325527 | + | 750 | WP_001148586.1 | phage antirepressor KilAC domain-containing protein | - |
| PQQ25_RS01760 (325543) | 325543..325641 | + | 99 | Protein_291 | hypothetical protein | - |
| PQQ25_RS01765 (325791) | 325791..326054 | + | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| PQQ25_RS01770 (326066) | 326066..326227 | + | 162 | WP_000066021.1 | DUF1270 family protein | - |
| PQQ25_RS01775 (326319) | 326319..326579 | + | 261 | WP_000291089.1 | DUF1108 family protein | - |
| PQQ25_RS01780 (326589) | 326589..326810 | + | 222 | WP_000815401.1 | DUF2483 family protein | - |
| PQQ25_RS01785 (326803) | 326803..327591 | + | 789 | WP_000134097.1 | ATP-binding protein | - |
| PQQ25_RS01790 (327620) | 327620..328171 | + | 552 | WP_000704705.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 320324..362645 | 42321 | ||
| inside | Prophage | - | geh | 315773..362645 | 46872 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 18100.42 Da Isoelectric Point: 4.7904
>T270154 WP_000525007.1 NZ_CP117242:c323227-322763 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEFSITFEPLRVFKLHHID
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEFSITFEPLRVFKLHHID
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A380E6V7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E7YIA0 |