Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | IasE-IsrA/- |
Location | 492066..492468 | Replicon | chromosome |
Accession | NZ_CP117181 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28S |
Toxin (Protein)
Gene name | IasE | Uniprot ID | A0A418Z3G0 |
Locus tag | PQP75_RS02375 | Protein ID | WP_017442176.1 |
Coordinates | 492223..492468 (+) | Length | 82 a.a. |
Antitoxin (RNA)
Gene name | IsrA | ||
Locus tag | - | ||
Coordinates | 492066..492373 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP75_RS02340 | 488498..489055 | + | 558 | Protein_451 | ATP-binding protein | - |
PQP75_RS02345 | 489123..489281 | - | 159 | Protein_452 | transposase | - |
PQP75_RS02350 | 489334..489648 | + | 315 | WP_072103451.1 | SymE family type I addiction module toxin | - |
PQP75_RS02355 | 489715..489993 | - | 279 | WP_077907264.1 | hypothetical protein | - |
PQP75_RS02360 | 490311..490778 | - | 468 | WP_017442178.1 | hypothetical protein | - |
PQP75_RS02365 | 490775..491146 | - | 372 | WP_223195353.1 | hypothetical protein | - |
PQP75_RS02370 | 491596..491889 | - | 294 | WP_129369132.1 | hypothetical protein | - |
- | 492066..492373 | - | 308 | - | - | Antitoxin |
PQP75_RS02375 | 492223..492468 | + | 246 | WP_017442176.1 | hypothetical protein | Toxin |
PQP75_RS02380 | 492535..492891 | - | 357 | WP_017442175.1 | hypothetical protein | - |
PQP75_RS02385 | 492888..493265 | - | 378 | WP_223195355.1 | HNH endonuclease | - |
PQP75_RS02390 | 493470..494048 | - | 579 | WP_017442174.1 | hypothetical protein | - |
PQP75_RS02395 | 494050..494328 | - | 279 | WP_197398372.1 | hypothetical protein | - |
PQP75_RS02400 | 494349..494501 | - | 153 | WP_223195354.1 | hypothetical protein | - |
PQP75_RS02405 | 494860..495306 | - | 447 | WP_017442172.1 | hypothetical protein | - |
PQP75_RS02410 | 495303..495584 | - | 282 | WP_176132412.1 | hypothetical protein | - |
PQP75_RS02415 | 495699..495815 | - | 117 | Protein_466 | RHS repeat-associated core domain-containing protein | - |
PQP75_RS02420 | 495998..496225 | + | 228 | WP_017442171.1 | SymE family type I addiction module toxin | - |
PQP75_RS02425 | 496278..496760 | - | 483 | WP_017442170.1 | immunity 26/phosphotriesterase HocA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 479219..523589 | 44370 | |
- | flank | IS/Tn | - | - | 488678..489055 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 82 a.a. Molecular weight: 8761.95 Da Isoelectric Point: 4.3010
>T270014 WP_017442176.1 NZ_CP117181:492223-492468 [Salmonella enterica subsp. enterica serovar Mbandaka]
MNASGASVRHINSETCMTACYSQIPSGDCQEEAGFETGRSVTVKISDGCIVLMADGNEVQKLCEQLYKAEQVVKGMWDVI
V
MNASGASVRHINSETCMTACYSQIPSGDCQEEAGFETGRSVTVKISDGCIVLMADGNEVQKLCEQLYKAEQVVKGMWDVI
V
Download Length: 246 bp
Antitoxin
Download Length: 308 bp
>AT270014 NZ_CP117181:c492373-492066 [Salmonella enterica subsp. enterica serovar Mbandaka]
CAATACACCCGTCCGAAATCTTCACCGTCACGCTGCGCCCGGTCTCAAATCCCGCTTCTTCCTGGCAGTCGCCGCTGGGG
ATTTGTGAGTAACAGGCGGTCATGCAGGTTTCGCTGTTGATGTGGCGGACGCTGGCGCCGGAGGCATTCATATTTGCTGA
CTAAATAAATTCTTAATTCTCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTGAGCGAGTATGGGCGCGACATCATGG
CACCGCGCCTCCCTCTCCCCGGCCAGCACCGGGCGGTGATGAGCAACCGGCTGCCGGGGCCGTATTTT
CAATACACCCGTCCGAAATCTTCACCGTCACGCTGCGCCCGGTCTCAAATCCCGCTTCTTCCTGGCAGTCGCCGCTGGGG
ATTTGTGAGTAACAGGCGGTCATGCAGGTTTCGCTGTTGATGTGGCGGACGCTGGCGCCGGAGGCATTCATATTTGCTGA
CTAAATAAATTCTTAATTCTCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTGAGCGAGTATGGGCGCGACATCATGG
CACCGCGCCTCCCTCTCCCCGGCCAGCACCGGGCGGTGATGAGCAACCGGCTGCCGGGGCCGTATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|