Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1718434..1718654 | Replicon | chromosome |
Accession | NZ_CP115183 | ||
Organism | Clostridioides difficile R20291 |
Toxin (Protein)
Gene name | CD0956.2 | Uniprot ID | Q183Z5 |
Locus tag | O9S30_RS08095 | Protein ID | WP_003429855.1 |
Coordinates | 1718434..1718595 (+) | Length | 54 a.a. |
Antitoxin (RNA)
Gene name | RCd10 | ||
Locus tag | - | ||
Coordinates | 1718515..1718654 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O9S30_RS08065 (O9S30_08065) | 1714291..1714728 | + | 438 | WP_009888839.1 | hypothetical protein | - |
O9S30_RS08070 (O9S30_08070) | 1714721..1714897 | + | 177 | WP_009888840.1 | hypothetical protein | - |
O9S30_RS08075 (O9S30_08075) | 1714898..1716208 | + | 1311 | WP_009893136.1 | phage tail sheath family protein | - |
O9S30_RS08080 (O9S30_08080) | 1716225..1716695 | + | 471 | WP_009888842.1 | phage tail tube protein | - |
O9S30_RS08085 (O9S30_08085) | 1716754..1717581 | + | 828 | WP_009888843.1 | hypothetical protein | - |
O9S30_RS08090 (O9S30_08090) | 1717653..1718093 | + | 441 | WP_003429853.1 | phage portal protein | - |
O9S30_RS08095 (O9S30_08095) | 1718434..1718595 | + | 162 | WP_003429855.1 | hypothetical protein | Toxin |
- | 1718515..1718654 | - | 140 | - | - | Antitoxin |
O9S30_RS08100 (O9S30_08100) | 1719932..1720120 | + | 189 | WP_003429858.1 | hypothetical protein | - |
O9S30_RS08105 (O9S30_08105) | 1720239..1721105 | + | 867 | WP_009888845.1 | BRO family protein | - |
O9S30_RS08110 (O9S30_08110) | 1721158..1721292 | + | 135 | WP_009888846.1 | hypothetical protein | - |
O9S30_RS08115 (O9S30_08115) | 1721970..1722497 | + | 528 | WP_009888847.1 | DUF4352 domain-containing protein | - |
O9S30_RS08120 (O9S30_08120) | 1722635..1723402 | + | 768 | WP_009888848.1 | DUF4428 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1684645..1751782 | 67137 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T267072 WP_003429855.1 NZ_CP115183:1718434-1718595 [Clostridioides difficile R20291]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
Antitoxin
Download Length: 140 bp
>AT267072 NZ_CP115183:c1718654-1718515 [Clostridioides difficile R20291]
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|