Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1100886..1101412 | Replicon | chromosome |
| Accession | NZ_CP114896 | ||
| Organism | Escherichia coli strain CM93 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | O6117_RS05455 | Protein ID | WP_000323025.1 |
| Coordinates | 1100886..1101173 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | O6117_RS05460 | Protein ID | WP_000534858.1 |
| Coordinates | 1101173..1101412 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6117_RS05405 (1095910) | 1095910..1096125 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| O6117_RS05410 (1096345) | 1096345..1096515 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| O6117_RS05415 (1096879) | 1096879..1097094 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| O6117_RS05420 (1097395) | 1097395..1097607 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| O6117_RS05425 (1097662) | 1097662..1097751 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| O6117_RS05430 (1098029) | 1098029..1098781 | - | 753 | WP_001047135.1 | antitermination protein | - |
| O6117_RS05435 (1098795) | 1098795..1099844 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| O6117_RS05440 (1099846) | 1099846..1100124 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| O6117_RS05445 (1100191) | 1100191..1100442 | - | 252 | WP_000980994.1 | protein Rem | - |
| O6117_RS05450 (1100659) | 1100659..1100814 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| O6117_RS05455 (1100886) | 1100886..1101173 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| O6117_RS05460 (1101173) | 1101173..1101412 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| O6117_RS05465 (1101437) | 1101437..1101742 | + | 306 | WP_001326990.1 | protein YdfV | - |
| O6117_RS05470 (1101945) | 1101945..1102277 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
| O6117_RS05475 (1102714) | 1102714..1102863 | - | 150 | WP_011443592.1 | protein YdfW | - |
| O6117_RS05480 (1102898) | 1102898..1103176 | - | 279 | Protein_1068 | protein YdfX | - |
| O6117_RS05485 (1103160) | 1103160..1103390 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
| O6117_RS05490 (1103474) | 1103474..1103881 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
| O6117_RS05495 (1104048) | 1104048..1104203 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
| O6117_RS05500 (1104205) | 1104205..1104333 | + | 129 | WP_000344964.1 | protein YdfB | - |
| O6117_RS05505 (1104363) | 1104363..1104581 | + | 219 | WP_001171942.1 | protein YdfC | - |
| O6117_RS05510 (1105149) | 1105149..1105337 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
| O6117_RS05515 (1105334) | 1105334..1105525 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
| O6117_RS05520 (1105618) | 1105618..1106385 | + | 768 | Protein_1076 | exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1086542..1109584 | 23042 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T267021 WP_000323025.1 NZ_CP114896:c1101173-1100886 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|