Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2285655..2286181 | Replicon | chromosome |
Accession | NZ_CP114895 | ||
Organism | Escherichia coli strain CM56 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | O6106_RS11280 | Protein ID | WP_000323025.1 |
Coordinates | 2285655..2285942 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | O6106_RS11285 | Protein ID | WP_000534858.1 |
Coordinates | 2285942..2286181 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6106_RS11230 (2280679) | 2280679..2280894 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
O6106_RS11235 (2281114) | 2281114..2281284 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
O6106_RS11240 (2281648) | 2281648..2281863 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
O6106_RS11245 (2282164) | 2282164..2282376 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
O6106_RS11250 (2282431) | 2282431..2282520 | + | 90 | WP_120795389.1 | hypothetical protein | - |
O6106_RS11255 (2282798) | 2282798..2283550 | - | 753 | WP_001047135.1 | antitermination protein | - |
O6106_RS11260 (2283564) | 2283564..2284613 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
O6106_RS11265 (2284615) | 2284615..2284893 | - | 279 | WP_012304870.1 | hypothetical protein | - |
O6106_RS11270 (2284960) | 2284960..2285211 | - | 252 | WP_000980994.1 | protein Rem | - |
O6106_RS11275 (2285428) | 2285428..2285583 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
O6106_RS11280 (2285655) | 2285655..2285942 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
O6106_RS11285 (2285942) | 2285942..2286181 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
O6106_RS11290 (2286206) | 2286206..2286511 | + | 306 | WP_001326990.1 | protein YdfV | - |
O6106_RS11295 (2286714) | 2286714..2287046 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
O6106_RS11300 (2287483) | 2287483..2287632 | - | 150 | WP_011443592.1 | protein YdfW | - |
O6106_RS11305 (2287667) | 2287667..2287945 | - | 279 | Protein_2188 | protein YdfX | - |
O6106_RS11310 (2287929) | 2287929..2288159 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
O6106_RS11315 (2288243) | 2288243..2288650 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
O6106_RS11320 (2288817) | 2288817..2288972 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
O6106_RS11325 (2288974) | 2288974..2289102 | + | 129 | WP_000344964.1 | protein YdfB | - |
O6106_RS11330 (2289132) | 2289132..2289350 | + | 219 | WP_001171942.1 | protein YdfC | - |
O6106_RS11335 (2289918) | 2289918..2290106 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
O6106_RS11340 (2290103) | 2290103..2290294 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
O6106_RS11345 (2290387) | 2290387..2291154 | + | 768 | Protein_2196 | exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2271311..2294353 | 23042 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T267002 WP_000323025.1 NZ_CP114895:c2285942-2285655 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|