Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1910376..1910558 | Replicon | chromosome |
Accession | NC_017347 | ||
Organism | Staphylococcus aureus subsp. aureus T0131 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAT0131_RS15790 | Protein ID | WP_001801861.1 |
Coordinates | 1910376..1910471 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1910499..1910558 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAT0131_RS09395 | 1906036..1906662 | + | 627 | WP_000669049.1 | hypothetical protein | - |
SAT0131_RS09400 | 1906703..1907047 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
SAT0131_RS09405 | 1907145..1907696 | + | 552 | WP_000414205.1 | hypothetical protein | - |
SAT0131_RS09410 | 1907914..1908555 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAT0131_RS09415 | 1908669..1908854 | - | 186 | WP_000809857.1 | hypothetical protein | - |
SAT0131_RS09420 | 1908856..1909032 | - | 177 | WP_000375476.1 | hypothetical protein | - |
SAT0131_RS09425 | 1909043..1909426 | - | 384 | WP_000070811.1 | hypothetical protein | - |
SAT0131_RS09435 | 1910030..1910173 | - | 144 | WP_001549059.1 | transposase | - |
SAT0131_RS15790 | 1910376..1910471 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1910499..1910558 | - | 60 | - | - | Antitoxin |
SAT0131_RS09440 | 1910594..1910695 | + | 102 | WP_001791893.1 | hypothetical protein | - |
SAT0131_RS15370 | 1910673..1910849 | - | 177 | Protein_1822 | transposase | - |
SAT0131_RS09445 | 1911043..1911420 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1903476..1940652 | 37176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T26699 WP_001801861.1 NC_017347:1910376-1910471 [Staphylococcus aureus subsp. aureus T0131]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T26699 NC_017347:1910376-1910471 [Staphylococcus aureus subsp. aureus T0131]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT26699 NC_017347:c1910558-1910499 [Staphylococcus aureus subsp. aureus T0131]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|