Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3901022..3901836 | Replicon | chromosome |
Accession | NZ_CP114894 | ||
Organism | Escherichia coli strain CM19 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | O6X69_RS19065 | Protein ID | WP_001054376.1 |
Coordinates | 3901579..3901836 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | O6X69_RS19060 | Protein ID | WP_001309181.1 |
Coordinates | 3901022..3901567 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6X69_RS19030 (3896713) | 3896713..3898026 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
O6X69_RS19035 (3898038) | 3898038..3898316 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
O6X69_RS19040 (3898313) | 3898313..3899434 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
O6X69_RS19045 (3899679) | 3899679..3899795 | - | 117 | Protein_3699 | VOC family protein | - |
O6X69_RS19050 (3899833) | 3899833..3900051 | - | 219 | Protein_3700 | hypothetical protein | - |
O6X69_RS19055 (3900220) | 3900220..3900966 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
O6X69_RS19060 (3901022) | 3901022..3901567 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
O6X69_RS19065 (3901579) | 3901579..3901836 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
O6X69_RS19070 (3902327) | 3902327..3902458 | - | 132 | WP_001309182.1 | hypothetical protein | - |
O6X69_RS19075 (3902574) | 3902574..3903814 | + | 1241 | Protein_3705 | helicase YjhR | - |
O6X69_RS19080 (3904082) | 3904082..3904287 | - | 206 | Protein_3706 | HNH endonuclease | - |
O6X69_RS19085 (3904397) | 3904397..3905377 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
O6X69_RS19090 (3905442) | 3905442..3906548 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3893335..3917274 | 23939 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T266985 WP_001054376.1 NZ_CP114894:c3901836-3901579 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT266985 WP_001309181.1 NZ_CP114894:c3901567-3901022 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|