Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2481533..2481758 | Replicon | chromosome |
| Accession | NZ_CP114130 | ||
| Organism | Escherichia coli strain NJS001 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | N0F11_RS12315 | Protein ID | WP_000813258.1 |
| Coordinates | 2481533..2481688 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2481700..2481758 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0F11_RS12265 | 2476536..2476967 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
| N0F11_RS12280 | 2477418..2478131 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| N0F11_RS12285 | 2478267..2478464 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| N0F11_RS12290 | 2478689..2479243 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| N0F11_RS12295 | 2479306..2479611 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N0F11_RS12300 | 2479624..2480673 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| N0F11_RS12305 | 2480675..2480947 | - | 273 | WP_000191872.1 | hypothetical protein | - |
| N0F11_RS12310 | 2481069..2481413 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| N0F11_RS12315 | 2481533..2481688 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| - | 2481700..2481758 | + | 59 | - | - | Antitoxin |
| N0F11_RS12320 | 2481979..2482536 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| N0F11_RS12325 | 2482538..2482756 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| N0F11_RS12330 | 2482884..2483195 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| N0F11_RS12335 | 2483188..2483415 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| N0F11_RS12340 | 2483412..2483693 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| N0F11_RS12345 | 2483726..2484442 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| N0F11_RS12350 | 2484476..2484937 | - | 462 | WP_000139447.1 | replication protein P | - |
| N0F11_RS12355 | 2484930..2485973 | - | 1044 | WP_001262402.1 | DnaT-like ssDNA-binding domain-containing protein | - |
| N0F11_RS12360 | 2486042..2486467 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
| N0F11_RS12365 | 2486451..2486693 | - | 243 | WP_000747948.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | nleG7' | 2443203..2543786 | 100583 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T266303 WP_000813258.1 NZ_CP114130:c2481688-2481533 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT266303 NZ_CP114130:2481700-2481758 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
