Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1008220..1009034 | Replicon | chromosome |
Accession | NZ_CP113537 | ||
Organism | Salmonella enterica strain YZY |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | - |
Locus tag | OXV04_RS04820 | Protein ID | WP_126523877.1 |
Coordinates | 1008220..1008747 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | OXV04_RS04825 | Protein ID | WP_000855694.1 |
Coordinates | 1008744..1009034 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV04_RS04800 (1003520) | 1003520..1006087 | - | 2568 | WP_001005802.1 | DNA mismatch repair protein MutS | - |
OXV04_RS04805 (1006246) | 1006246..1006767 | + | 522 | WP_061383865.1 | hypothetical protein | - |
OXV04_RS04810 (1006939) | 1006939..1007595 | - | 657 | WP_058821376.1 | protein-serine/threonine phosphatase | - |
OXV04_RS04815 (1007930) | 1007930..1008147 | + | 218 | Protein_944 | IS5/IS1182 family transposase | - |
OXV04_RS04820 (1008220) | 1008220..1008747 | - | 528 | WP_126523877.1 | GNAT family N-acetyltransferase | Toxin |
OXV04_RS04825 (1008744) | 1008744..1009034 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
OXV04_RS04830 (1009304) | 1009304..1009489 | - | 186 | Protein_947 | IS3 family transposase | - |
OXV04_RS04835 (1009744) | 1009744..1010070 | + | 327 | WP_000393302.1 | hypothetical protein | - |
OXV04_RS04840 (1010343) | 1010343..1010690 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
OXV04_RS04845 (1010675) | 1010675..1011124 | - | 450 | WP_023261375.1 | hypothetical protein | - |
OXV04_RS04850 (1011555) | 1011555..1011998 | - | 444 | WP_126523878.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
OXV04_RS04855 (1012455) | 1012455..1013105 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1006939..1018418 | 11479 | ||
- | flank | IS/Tn | - | - | 1008007..1008147 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19097.96 Da Isoelectric Point: 9.6420
>T265938 WP_126523877.1 NZ_CP113537:c1008747-1008220 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHVRQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHVRQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|