Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 993001..993815 | Replicon | chromosome |
Accession | NZ_CP113534 | ||
Organism | Salmonella enterica strain ZYX |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | OXV08_RS04725 | Protein ID | WP_000971655.1 |
Coordinates | 993001..993528 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A4Y6M833 |
Locus tag | OXV08_RS04730 | Protein ID | WP_072162154.1 |
Coordinates | 993525..993815 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV08_RS04705 (988303) | 988303..990870 | - | 2568 | WP_020437800.1 | DNA mismatch repair protein MutS | - |
OXV08_RS04710 (991029) | 991029..991549 | + | 521 | Protein_923 | cytoplasmic protein | - |
OXV08_RS04715 (991720) | 991720..992376 | - | 657 | WP_020839120.1 | protein-serine/threonine phosphatase | - |
OXV08_RS04720 (992711) | 992711..992928 | + | 218 | Protein_925 | IS5/IS1182 family transposase | - |
OXV08_RS04725 (993001) | 993001..993528 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
OXV08_RS04730 (993525) | 993525..993815 | - | 291 | WP_072162154.1 | DUF1778 domain-containing protein | Antitoxin |
OXV08_RS04735 (994085) | 994085..994263 | - | 179 | Protein_928 | IS3 family transposase | - |
OXV08_RS04740 (994504) | 994504..994830 | + | 327 | WP_268653131.1 | hypothetical protein | - |
OXV08_RS04745 (995103) | 995103..995450 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
OXV08_RS04750 (995435) | 995435..995889 | - | 455 | Protein_931 | hypothetical protein | - |
OXV08_RS04755 (996321) | 996321..996764 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
OXV08_RS04760 (997220) | 997220..997870 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 991720..1003183 | 11463 | ||
- | flank | IS/Tn | - | - | 992788..992928 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T265884 WP_000971655.1 NZ_CP113534:c993528-993001 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y6M833 |