Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | IasE-IsrA/SymE(toxin) |
Location | 3589636..3589842 | Replicon | chromosome |
Accession | NZ_CP113364 | ||
Organism | Salmonella enterica subsp. enterica strain KNP01 |
Toxin (Protein)
Gene name | IasE | Uniprot ID | A0A3Y1TUH5 |
Locus tag | OU685_RS17655 | Protein ID | WP_026080916.1 |
Coordinates | 3589636..3589842 (+) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | IsrA | ||
Locus tag | - | ||
Coordinates | 3589647..3589832 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU685_RS17620 | 3584781..3585008 | + | 228 | WP_017442171.1 | SymE family type I addiction module toxin | - |
OU685_RS17625 | 3585061..3585543 | - | 483 | WP_017442170.1 | immunity 26/phosphotriesterase HocA family protein | - |
OU685_RS17630 | 3586062..3586508 | - | 447 | WP_000935097.1 | protein SciX | - |
OU685_RS17635 | 3586502..3587470 | - | 969 | Protein_3447 | polymorphic toxin type 47 domain-containing protein | - |
OU685_RS17640 | 3587896..3588030 | + | 135 | Protein_3448 | SymE family type I addiction module toxin | - |
OU685_RS17645 | 3588099..3588386 | - | 288 | WP_017442165.1 | hypothetical protein | - |
OU685_RS17650 | 3588389..3589642 | - | 1254 | Protein_3450 | RHS domain-containing protein | - |
OU685_RS17655 | 3589636..3589842 | + | 207 | WP_026080916.1 | SymE family type I addiction module toxin | Toxin |
- | 3589647..3589832 | - | 186 | - | - | Antitoxin |
OU685_RS17660 | 3589889..3590167 | - | 279 | WP_017442162.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3568002..3612372 | 44370 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7592.80 Da Isoelectric Point: 6.4569
>T265695 WP_026080916.1 NZ_CP113364:3589636-3589842 [Salmonella enterica subsp. enterica]
IPELHLKGDWLAEAGFETGTSVTVKISEGCLILIAETDEVRDLRKELYLVKKSMKHIKAGVNNVVNRD
IPELHLKGDWLAEAGFETGTSVTVKISEGCLILIAETDEVRDLRKELYLVKKSMKHIKAGVNNVVNRD
Download Length: 207 bp
Antitoxin
Download Length: 186 bp
>AT265695 NZ_CP113364:c3589832-3589647 [Salmonella enterica subsp. enterica]
TTCACCACATTATTTACCCCCGCCTTAATATGCTTCATCGACTTTTTCACCAGATAAAGCTCCTTCCGTAGATCCCTCAC
TTCGTCCGTCTCTGCAATCAGGATCAAACACCCCTCCGAGATCTTCACGGTTACGCTCGTCCCGGTCTCAAATCCCGCCT
CGGCCAGCCAGTCGCCCTTAAGATGC
TTCACCACATTATTTACCCCCGCCTTAATATGCTTCATCGACTTTTTCACCAGATAAAGCTCCTTCCGTAGATCCCTCAC
TTCGTCCGTCTCTGCAATCAGGATCAAACACCCCTCCGAGATCTTCACGGTTACGCTCGTCCCGGTCTCAAATCCCGCCT
CGGCCAGCCAGTCGCCCTTAAGATGC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|