Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | IasE-IsrA/- |
Location | 3580849..3581251 | Replicon | chromosome |
Accession | NZ_CP113364 | ||
Organism | Salmonella enterica subsp. enterica strain KNP01 |
Toxin (Protein)
Gene name | IasE | Uniprot ID | A0A418Z3G0 |
Locus tag | OU685_RS17575 | Protein ID | WP_017442176.1 |
Coordinates | 3581006..3581251 (+) | Length | 82 a.a. |
Antitoxin (RNA)
Gene name | IsrA | ||
Locus tag | - | ||
Coordinates | 3580849..3581156 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU685_RS17540 | 3577281..3577838 | + | 558 | Protein_3428 | ATP-binding protein | - |
OU685_RS17545 | 3577906..3578064 | - | 159 | Protein_3429 | transposase | - |
OU685_RS17550 | 3578117..3578431 | + | 315 | WP_072103451.1 | SymE family type I addiction module toxin | - |
OU685_RS17555 | 3578498..3578776 | - | 279 | WP_077907264.1 | hypothetical protein | - |
OU685_RS17560 | 3579094..3579561 | - | 468 | WP_017442178.1 | hypothetical protein | - |
OU685_RS17565 | 3579558..3579929 | - | 372 | WP_223195353.1 | hypothetical protein | - |
OU685_RS17570 | 3580379..3580672 | - | 294 | WP_129369132.1 | hypothetical protein | - |
- | 3580849..3581156 | - | 308 | - | - | Antitoxin |
OU685_RS17575 | 3581006..3581251 | + | 246 | WP_017442176.1 | hypothetical protein | Toxin |
OU685_RS17580 | 3581318..3581674 | - | 357 | WP_017442175.1 | hypothetical protein | - |
OU685_RS17585 | 3581671..3582048 | - | 378 | WP_223195355.1 | HNH endonuclease | - |
OU685_RS17590 | 3582253..3582831 | - | 579 | WP_017442174.1 | hypothetical protein | - |
OU685_RS17595 | 3582833..3583111 | - | 279 | WP_197398372.1 | hypothetical protein | - |
OU685_RS17600 | 3583132..3583284 | - | 153 | WP_223195354.1 | hypothetical protein | - |
OU685_RS17605 | 3583643..3584089 | - | 447 | WP_017442172.1 | hypothetical protein | - |
OU685_RS17610 | 3584086..3584367 | - | 282 | WP_176132412.1 | hypothetical protein | - |
OU685_RS17615 | 3584482..3584598 | - | 117 | Protein_3443 | RHS repeat-associated core domain-containing protein | - |
OU685_RS17620 | 3584781..3585008 | + | 228 | WP_017442171.1 | SymE family type I addiction module toxin | - |
OU685_RS17625 | 3585061..3585543 | - | 483 | WP_017442170.1 | immunity 26/phosphotriesterase HocA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3568002..3612372 | 44370 | |
- | flank | IS/Tn | - | - | 3577461..3577838 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 82 a.a. Molecular weight: 8761.95 Da Isoelectric Point: 4.3010
>T265691 WP_017442176.1 NZ_CP113364:3581006-3581251 [Salmonella enterica subsp. enterica]
MNASGASVRHINSETCMTACYSQIPSGDCQEEAGFETGRSVTVKISDGCIVLMADGNEVQKLCEQLYKAEQVVKGMWDVI
V
MNASGASVRHINSETCMTACYSQIPSGDCQEEAGFETGRSVTVKISDGCIVLMADGNEVQKLCEQLYKAEQVVKGMWDVI
V
Download Length: 246 bp
Antitoxin
Download Length: 308 bp
>AT265691 NZ_CP113364:c3581156-3580849 [Salmonella enterica subsp. enterica]
CAATACACCCGTCCGAAATCTTCACCGTCACGCTGCGCCCGGTCTCAAATCCCGCTTCTTCCTGGCAGTCGCCGCTGGGG
ATTTGTGAGTAACAGGCGGTCATGCAGGTTTCGCTGTTGATGTGGCGGACGCTGGCGCCGGAGGCATTCATATTTGCTGA
CTAAATAAATTCTTAATTCTCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTGAGCGAGTATGGGCGCGACATCATGG
CACCGCGCCTCCCTCTCCCCGGCCAGCACCGGGCGGTGATGAGCAACCGGCTGCCGGGGCCGTATTTT
CAATACACCCGTCCGAAATCTTCACCGTCACGCTGCGCCCGGTCTCAAATCCCGCTTCTTCCTGGCAGTCGCCGCTGGGG
ATTTGTGAGTAACAGGCGGTCATGCAGGTTTCGCTGTTGATGTGGCGGACGCTGGCGCCGGAGGCATTCATATTTGCTGA
CTAAATAAATTCTTAATTCTCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTGAGCGAGTATGGGCGCGACATCATGG
CACCGCGCCTCCCTCTCCCCGGCCAGCACCGGGCGGTGATGAGCAACCGGCTGCCGGGGCCGTATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|