Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1952846..1953028 | Replicon | chromosome |
| Accession | NC_017331 | ||
| Organism | Staphylococcus aureus subsp. aureus TW20 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SATW20_RS16795 | Protein ID | WP_001801861.1 |
| Coordinates | 1952846..1952941 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1952969..1953028 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SATW20_RS09665 | 1948506..1949132 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| SATW20_RS09670 | 1949173..1949517 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| SATW20_RS09675 | 1949615..1950166 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| SATW20_RS09680 | 1950384..1951025 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SATW20_RS09685 | 1951139..1951324 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| SATW20_RS09690 | 1951326..1951502 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| SATW20_RS09695 | 1951513..1951896 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| SATW20_RS09705 | 1952500..1952643 | - | 144 | WP_001549059.1 | transposase | - |
| SATW20_RS16795 | 1952846..1952941 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1952969..1953028 | - | 60 | - | - | Antitoxin |
| SATW20_RS09710 | 1953064..1953165 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| SATW20_RS16355 | 1953143..1953319 | - | 177 | Protein_1877 | transposase | - |
| SATW20_RS09715 | 1953513..1953890 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| SATW20_RS09720 | 1954411..1955679 | - | 1269 | Protein_1879 | ATP-binding protein | - |
| SATW20_RS09730 | 1955731..1956902 | - | 1172 | Protein_1880 | IS256-like element IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA | 1945946..1986197 | 40251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T26554 WP_001801861.1 NC_017331:1952846-1952941 [Staphylococcus aureus subsp. aureus TW20]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T26554 NC_017331:1952846-1952941 [Staphylococcus aureus subsp. aureus TW20]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT26554 NC_017331:c1953028-1952969 [Staphylococcus aureus subsp. aureus TW20]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|