Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1780644..1781323 | Replicon | chromosome |
Accession | NZ_CP113074 | ||
Organism | Acinetobacter baumannii strain ATCC17978 TnAraC-H0N27_12600 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S3TWT7 |
Locus tag | OSH15_RS08525 | Protein ID | WP_000838146.1 |
Coordinates | 1780644..1780826 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | N9L2H6 |
Locus tag | OSH15_RS08530 | Protein ID | WP_000966688.1 |
Coordinates | 1780919..1781323 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSH15_RS08490 (OSH15_08495) | 1775887..1776285 | + | 399 | WP_001251846.1 | phage tail terminator-like protein | - |
OSH15_RS08495 (OSH15_08500) | 1776287..1776505 | + | 219 | WP_001277696.1 | hypothetical protein | - |
OSH15_RS08500 (OSH15_08505) | 1776614..1777135 | + | 522 | WP_000749906.1 | SH3 domain-containing protein | - |
OSH15_RS08505 (OSH15_08510) | 1777232..1777585 | + | 354 | WP_000064603.1 | hypothetical protein | - |
OSH15_RS08510 (OSH15_08515) | 1777585..1778763 | + | 1179 | WP_000002414.1 | hypothetical protein | - |
OSH15_RS08515 (OSH15_08520) | 1778816..1779733 | + | 918 | WP_000094261.1 | phage tail tube protein | - |
OSH15_RS08520 (OSH15_08525) | 1779803..1780318 | + | 516 | WP_001185604.1 | hypothetical protein | - |
OSH15_RS08525 (OSH15_08530) | 1780644..1780826 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OSH15_RS08530 (OSH15_08535) | 1780919..1781323 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OSH15_RS08535 (OSH15_08540) | 1781423..1781599 | + | 177 | WP_074031683.1 | hypothetical protein | - |
OSH15_RS08540 (OSH15_08545) | 1781608..1781931 | + | 324 | WP_000523932.1 | DUF4236 domain-containing protein | - |
OSH15_RS08545 (OSH15_08550) | 1781965..1782354 | + | 390 | WP_031977960.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1746620..1795958 | 49338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T265361 WP_000838146.1 NZ_CP113074:1780644-1780826 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT265361 WP_000966688.1 NZ_CP113074:1780919-1781323 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|