265254

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 178848..179028 Replicon chromosome
Accession NZ_CP113039
Organism Staphylococcus aureus strain Gwen

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag OS086_RS00815 Protein ID WP_001801861.1
Coordinates 178848..178943 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 178971..179028 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS086_RS00785 174011..174661 + 651 WP_001795210.1 excalibur calcium-binding domain-containing protein -
OS086_RS00790 174742..175737 + 996 WP_000070642.1 DUF4352 domain-containing protein -
OS086_RS00795 175812..176438 + 627 WP_000669024.1 hypothetical protein -
OS086_RS00800 176479..176820 + 342 WP_000627540.1 DUF3969 family protein -
OS086_RS00805 176921..177493 + 573 WP_000414216.1 hypothetical protein -
OS086_RS00810 177691..178703 - 1013 Protein_161 IS3 family transposase -
OS086_RS00815 178848..178943 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 178971..179028 - 58 - - Antitoxin
OS086_RS00820 179066..179167 + 102 WP_001792025.1 hypothetical protein -
OS086_RS00825 179145..179306 - 162 Protein_164 transposase -
OS086_RS00830 179291..179701 - 411 WP_001808705.1 IS21 family transposase -
OS086_RS00835 180243..181472 - 1230 WP_267811075.1 restriction endonuclease subunit S -
OS086_RS00840 181465..183021 - 1557 WP_000028663.1 type I restriction-modification system subunit M -
OS086_RS00845 183185..183319 - 135 WP_001791797.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA / selk 173253..209874 36621


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T265254 WP_001801861.1 NZ_CP113039:178848-178943 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT265254 NZ_CP113039:c179028-178971 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References