Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 178848..179028 | Replicon | chromosome |
| Accession | NZ_CP113039 | ||
| Organism | Staphylococcus aureus strain Gwen | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | OS086_RS00815 | Protein ID | WP_001801861.1 |
| Coordinates | 178848..178943 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 178971..179028 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS086_RS00785 | 174011..174661 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| OS086_RS00790 | 174742..175737 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| OS086_RS00795 | 175812..176438 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| OS086_RS00800 | 176479..176820 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| OS086_RS00805 | 176921..177493 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| OS086_RS00810 | 177691..178703 | - | 1013 | Protein_161 | IS3 family transposase | - |
| OS086_RS00815 | 178848..178943 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 178971..179028 | - | 58 | - | - | Antitoxin |
| OS086_RS00820 | 179066..179167 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| OS086_RS00825 | 179145..179306 | - | 162 | Protein_164 | transposase | - |
| OS086_RS00830 | 179291..179701 | - | 411 | WP_001808705.1 | IS21 family transposase | - |
| OS086_RS00835 | 180243..181472 | - | 1230 | WP_267811075.1 | restriction endonuclease subunit S | - |
| OS086_RS00840 | 181465..183021 | - | 1557 | WP_000028663.1 | type I restriction-modification system subunit M | - |
| OS086_RS00845 | 183185..183319 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 173253..209874 | 36621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T265254 WP_001801861.1 NZ_CP113039:178848-178943 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT265254 NZ_CP113039:c179028-178971 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|