Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1572555..1572737 Replicon chromosome
Accession NZ_CP113009
Organism Staphylococcus aureus strain Orianna

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag OS092_RS07790 Protein ID WP_001801861.1
Coordinates 1572555..1572650 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1572678..1572737 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS092_RS07750 1568215..1568841 + 627 WP_000669046.1 hypothetical protein -
OS092_RS07755 1568882..1569226 + 345 WP_000627551.1 DUF3969 family protein -
OS092_RS07760 1569324..1569875 + 552 WP_267793679.1 hypothetical protein -
OS092_RS07765 1570093..1570734 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
OS092_RS07770 1570848..1571033 - 186 WP_000809857.1 hypothetical protein -
OS092_RS07775 1571035..1571211 - 177 WP_000375476.1 hypothetical protein -
OS092_RS07780 1571222..1571605 - 384 WP_000070811.1 hypothetical protein -
OS092_RS07785 1572209..1572352 - 144 WP_001549059.1 transposase -
OS092_RS07790 1572555..1572650 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1572678..1572737 - 60 - - Antitoxin
OS092_RS07795 1572773..1572874 + 102 WP_001791893.1 hypothetical protein -
OS092_RS07800 1572852..1573028 - 177 Protein_1535 transposase -
OS092_RS07805 1573222..1573599 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA 1565655..1604162 38507


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T265133 WP_001801861.1 NZ_CP113009:1572555-1572650 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT265133 NZ_CP113009:c1572737-1572678 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References