Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1572555..1572737 | Replicon | chromosome |
| Accession | NZ_CP113009 | ||
| Organism | Staphylococcus aureus strain Orianna | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | OS092_RS07790 | Protein ID | WP_001801861.1 |
| Coordinates | 1572555..1572650 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1572678..1572737 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS092_RS07750 | 1568215..1568841 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| OS092_RS07755 | 1568882..1569226 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| OS092_RS07760 | 1569324..1569875 | + | 552 | WP_267793679.1 | hypothetical protein | - |
| OS092_RS07765 | 1570093..1570734 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OS092_RS07770 | 1570848..1571033 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| OS092_RS07775 | 1571035..1571211 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| OS092_RS07780 | 1571222..1571605 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| OS092_RS07785 | 1572209..1572352 | - | 144 | WP_001549059.1 | transposase | - |
| OS092_RS07790 | 1572555..1572650 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1572678..1572737 | - | 60 | - | - | Antitoxin |
| OS092_RS07795 | 1572773..1572874 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| OS092_RS07800 | 1572852..1573028 | - | 177 | Protein_1535 | transposase | - |
| OS092_RS07805 | 1573222..1573599 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA | 1565655..1604162 | 38507 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T265133 WP_001801861.1 NZ_CP113009:1572555-1572650 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT265133 NZ_CP113009:c1572737-1572678 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|