Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1401299..1401481 Replicon chromosome
Accession NZ_CP113005
Organism Staphylococcus aureus strain Galio

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag OS073_RS07125 Protein ID WP_001801861.1
Coordinates 1401299..1401394 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1401422..1401481 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS073_RS07085 1396959..1397585 + 627 WP_000669046.1 hypothetical protein -
OS073_RS07090 1397626..1397970 + 345 WP_000627551.1 DUF3969 family protein -
OS073_RS07095 1398068..1398619 + 552 WP_267793679.1 hypothetical protein -
OS073_RS07100 1398837..1399478 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
OS073_RS07105 1399592..1399777 - 186 WP_000809857.1 hypothetical protein -
OS073_RS07110 1399779..1399955 - 177 WP_000375476.1 hypothetical protein -
OS073_RS07115 1399966..1400349 - 384 WP_000070811.1 hypothetical protein -
OS073_RS07120 1400953..1401096 - 144 WP_001549059.1 transposase -
OS073_RS07125 1401299..1401394 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1401422..1401481 - 60 - - Antitoxin
OS073_RS07130 1401517..1401618 + 102 WP_001791893.1 hypothetical protein -
OS073_RS07135 1401596..1401772 - 177 Protein_1357 transposase -
OS073_RS07140 1401966..1402343 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA 1394399..1432906 38507


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T265100 WP_001801861.1 NZ_CP113005:1401299-1401394 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT265100 NZ_CP113005:c1401481-1401422 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References