262436

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 173689..173869 Replicon chromosome
Accession NZ_CP109933
Organism Staphylococcus aureus strain SASWT1215

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag NT398_RS01095 Protein ID WP_001801861.1
Coordinates 173774..173869 (-) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 173689..173746 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NT398_RS01065 169398..169532 + 135 WP_001791797.1 hypothetical protein -
NT398_RS01070 169696..171252 + 1557 WP_000028669.1 type I restriction-modification system subunit M -
NT398_RS01075 171245..172474 + 1230 WP_000072627.1 restriction endonuclease subunit S -
NT398_RS01080 173016..173426 + 411 WP_001808705.1 IS21 family transposase -
NT398_RS01085 173411..173572 + 162 Protein_177 transposase -
NT398_RS01090 173550..173651 - 102 WP_001792025.1 hypothetical protein -
- 173689..173746 + 58 - - Antitoxin
NT398_RS01095 173774..173869 - 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
NT398_RS01100 174014..175026 + 1013 Protein_180 IS3 family transposase -
NT398_RS01105 175224..175796 - 573 WP_000414216.1 hypothetical protein -
NT398_RS01110 175897..176238 - 342 WP_000627540.1 DUF3969 family protein -
NT398_RS01115 176279..176905 - 627 WP_000669024.1 hypothetical protein -
NT398_RS01120 176980..177975 - 996 WP_000070642.1 DUF4352 domain-containing protein -
NT398_RS01125 178056..178706 - 651 WP_001795210.1 excalibur calcium-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - selk / hlgA / lukD 146859..178670 31811


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T262436 WP_001801861.1 NZ_CP109933:c173869-173774 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT262436 NZ_CP109933:173689-173746 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References