Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 173689..173869 | Replicon | chromosome |
| Accession | NZ_CP109933 | ||
| Organism | Staphylococcus aureus strain SASWT1215 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NT398_RS01095 | Protein ID | WP_001801861.1 |
| Coordinates | 173774..173869 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 173689..173746 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NT398_RS01065 | 169398..169532 | + | 135 | WP_001791797.1 | hypothetical protein | - |
| NT398_RS01070 | 169696..171252 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| NT398_RS01075 | 171245..172474 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| NT398_RS01080 | 173016..173426 | + | 411 | WP_001808705.1 | IS21 family transposase | - |
| NT398_RS01085 | 173411..173572 | + | 162 | Protein_177 | transposase | - |
| NT398_RS01090 | 173550..173651 | - | 102 | WP_001792025.1 | hypothetical protein | - |
| - | 173689..173746 | + | 58 | - | - | Antitoxin |
| NT398_RS01095 | 173774..173869 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| NT398_RS01100 | 174014..175026 | + | 1013 | Protein_180 | IS3 family transposase | - |
| NT398_RS01105 | 175224..175796 | - | 573 | WP_000414216.1 | hypothetical protein | - |
| NT398_RS01110 | 175897..176238 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
| NT398_RS01115 | 176279..176905 | - | 627 | WP_000669024.1 | hypothetical protein | - |
| NT398_RS01120 | 176980..177975 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| NT398_RS01125 | 178056..178706 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | selk / hlgA / lukD | 146859..178670 | 31811 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T262436 WP_001801861.1 NZ_CP109933:c173869-173774 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT262436 NZ_CP109933:173689-173746 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|