Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2179893..2180089 | Replicon | chromosome |
Accession | NZ_CP107552 | ||
Organism | Clostridioides difficile strain S0756_078 |
Toxin (Protein)
Gene name | CD1418.2 | Uniprot ID | D5Q3X5 |
Locus tag | J5O10_RS10360 | Protein ID | WP_003424190.1 |
Coordinates | 2179937..2180089 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | CD630_n00500 | ||
Locus tag | - | ||
Coordinates | 2179893..2179993 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
J5O10_RS10340 (2175160) | 2175160..2175417 | - | 258 | WP_003424182.1 | hypothetical protein | - |
J5O10_RS10345 (2175404) | 2175404..2175637 | - | 234 | WP_003424184.1 | hypothetical protein | - |
J5O10_RS10350 (2175825) | 2175825..2176013 | + | 189 | WP_003424185.1 | helix-turn-helix transcriptional regulator | - |
J5O10_RS10355 (2176216) | 2176216..2176347 | - | 132 | WP_003424186.1 | hypothetical protein | - |
- (2179893) | 2179893..2179993 | + | 101 | NuclAT_0 | - | Antitoxin |
- (2179893) | 2179893..2179993 | + | 101 | NuclAT_0 | - | Antitoxin |
J5O10_RS10360 (2179937) | 2179937..2180089 | - | 153 | WP_003424190.1 | hypothetical protein | Toxin |
J5O10_RS10365 (2180609) | 2180609..2180851 | + | 243 | WP_003424191.1 | hypothetical protein | - |
J5O10_RS10370 (2180932) | 2180932..2181462 | + | 531 | WP_003424192.1 | site-specific integrase | - |
J5O10_RS10375 (2182007) | 2182007..2182852 | + | 846 | WP_003424194.1 | DUF4878 domain-containing protein | - |
J5O10_RS10380 (2183076) | 2183076..2183240 | - | 165 | WP_003424195.1 | hypothetical protein | - |
J5O10_RS10385 (2183772) | 2183772..2183963 | - | 192 | WP_003424196.1 | carboxymuconolactone decarboxylase family protein | - |
J5O10_RS10390 (2183963) | 2183963..2184103 | - | 141 | WP_003424197.1 | hypothetical protein | - |
J5O10_RS10395 (2184363) | 2184363..2185004 | - | 642 | WP_003424198.1 | SdpI family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5744.78 Da Isoelectric Point: 10.6276
>T261731 WP_003424190.1 NZ_CP107552:c2180089-2179937 [Clostridioides difficile]
MDNFLQGILASLVASLIVYLTSKLFKKVKSHSGRSDFSFELEIKFKKNKH
MDNFLQGILASLVASLIVYLTSKLFKKVKSHSGRSDFSFELEIKFKKNKH
Download Length: 153 bp
Antitoxin
Download Length: 101 bp
>AT261731 NZ_CP107552:2179893-2179993 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTAGACGTAGAGTGAAGTTCAAATACTAATGTTTATTCTTTTTGAACTTGATTTCTAGTTC
AAAACTAAAGTCACTCCTGCC
AAGAAGAACTACAATCTATTTAGACGTAGAGTGAAGTTCAAATACTAATGTTTATTCTTTTTGAACTTGATTTCTAGTTC
AAAACTAAAGTCACTCCTGCC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|