Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1790439..1790621 | Replicon | chromosome |
| Accession | NC_016912 | ||
| Organism | Staphylococcus aureus subsp. aureus VC40 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SAVC_RS14350 | Protein ID | WP_001801861.1 |
| Coordinates | 1790439..1790534 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1790562..1790621 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAVC_RS08765 | 1786099..1786725 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| SAVC_RS08770 | 1786766..1787110 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| SAVC_RS08775 | 1787208..1787759 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| SAVC_RS08780 | 1787977..1788618 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SAVC_RS08785 | 1788732..1788917 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| SAVC_RS08790 | 1788919..1789095 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| SAVC_RS08795 | 1789106..1789489 | - | 384 | WP_000070812.1 | hypothetical protein | - |
| SAVC_RS08805 | 1790093..1790236 | - | 144 | WP_001549059.1 | transposase | - |
| SAVC_RS14350 | 1790439..1790534 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1790562..1790621 | - | 60 | - | - | Antitoxin |
| SAVC_RS08810 | 1790657..1790758 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| SAVC_RS14025 | 1790736..1790912 | - | 177 | Protein_1687 | transposase | - |
| SAVC_RS08815 | 1791106..1791483 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA | 1783539..1823710 | 40171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T26096 WP_001801861.1 NC_016912:1790439-1790534 [Staphylococcus aureus subsp. aureus VC40]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T26096 NC_016912:1790439-1790534 [Staphylococcus aureus subsp. aureus VC40]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT26096 NC_016912:c1790621-1790562 [Staphylococcus aureus subsp. aureus VC40]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|