260545

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 2069234..2069799 Replicon chromosome
Accession NZ_CP107113
Organism Clostridioides difficile strain R_cdtRKO10.3

Toxin (Protein)


Gene name relE Uniprot ID C7H6P5
Locus tag OGM24_RS09730 Protein ID WP_002596328.1
Coordinates 2069234..2069524 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C7H6P4
Locus tag OGM24_RS09735 Protein ID WP_005924829.1
Coordinates 2069521..2069799 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGM24_RS09700 (OGM24_09700) 2064830..2065291 + 462 WP_012816193.1 hypothetical protein -
OGM24_RS09705 (OGM24_09705) 2065736..2066149 + 414 WP_012816194.1 sigma factor-like helix-turn-helix DNA-binding protein -
OGM24_RS09710 (OGM24_09710) 2066251..2066703 + 453 WP_012816195.1 sigma-24 (feci) -
OGM24_RS09715 (OGM24_09715) 2066714..2067175 + 462 WP_009296689.1 sigma factor-like helix-turn-helix DNA-binding protein -
OGM24_RS09720 (OGM24_09720) 2067204..2067494 + 291 WP_024739841.1 DUF3847 domain-containing protein -
OGM24_RS09725 (OGM24_09725) 2067681..2069126 + 1446 WP_104732839.1 MobQ family relaxase -
OGM24_RS09730 (OGM24_09730) 2069234..2069524 - 291 WP_002596328.1 type II toxin-antitoxin system YafQ family toxin Toxin
OGM24_RS09735 (OGM24_09735) 2069521..2069799 - 279 WP_005924829.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OGM24_RS09740 (OGM24_09740) 2069926..2070324 + 399 WP_012816198.1 cysteine-rich VLP domain-containing protein -
OGM24_RS09745 (OGM24_09745) 2070438..2071172 + 735 WP_012816199.1 phage replisome organizer N-terminal domain-containing protein -
OGM24_RS09750 (OGM24_09750) 2071169..2072032 + 864 WP_104732840.1 ATP-binding protein -
OGM24_RS09755 (OGM24_09755) 2072076..2072270 + 195 WP_104732841.1 transposon-encoded TnpW family protein -
OGM24_RS09760 (OGM24_09760) 2072348..2072713 + 366 WP_104732842.1 hypothetical protein -
OGM24_RS09765 (OGM24_09765) 2072808..2073389 + 582 Protein_1840 TraM recognition domain-containing protein -
OGM24_RS09770 (OGM24_09770) 2073487..2073864 + 378 WP_009891894.1 TnpV protein -
OGM24_RS09775 (OGM24_09775) 2073878..2074159 + 282 WP_009891893.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Integrative and Conjugative Element - - 2057288..2154768 97480


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-94)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-90)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11112.87 Da        Isoelectric Point: 8.0630

>T260545 WP_002596328.1 NZ_CP107113:c2069524-2069234 [Clostridioides difficile]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK

Download         Length: 291 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10247.66 Da        Isoelectric Point: 4.4692

>AT260545 WP_005924829.1 NZ_CP107113:c2069799-2069521 [Clostridioides difficile]
MAGNTTNISIRMDADLKAQADALFTELGMNLTTAFNIFVRQSLREGGIPFEVRLEQPNKETVAAMLEAERIAKDPSVKGY
NDLDELFADLKR

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M4XBM1

Antitoxin

Source ID Structure
AlphaFold DB A0A1M4XB19

References