Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 2069234..2069799 | Replicon | chromosome |
| Accession | NZ_CP107113 | ||
| Organism | Clostridioides difficile strain R_cdtRKO10.3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C7H6P5 |
| Locus tag | OGM24_RS09730 | Protein ID | WP_002596328.1 |
| Coordinates | 2069234..2069524 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | C7H6P4 |
| Locus tag | OGM24_RS09735 | Protein ID | WP_005924829.1 |
| Coordinates | 2069521..2069799 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGM24_RS09700 (OGM24_09700) | 2064830..2065291 | + | 462 | WP_012816193.1 | hypothetical protein | - |
| OGM24_RS09705 (OGM24_09705) | 2065736..2066149 | + | 414 | WP_012816194.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| OGM24_RS09710 (OGM24_09710) | 2066251..2066703 | + | 453 | WP_012816195.1 | sigma-24 (feci) | - |
| OGM24_RS09715 (OGM24_09715) | 2066714..2067175 | + | 462 | WP_009296689.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| OGM24_RS09720 (OGM24_09720) | 2067204..2067494 | + | 291 | WP_024739841.1 | DUF3847 domain-containing protein | - |
| OGM24_RS09725 (OGM24_09725) | 2067681..2069126 | + | 1446 | WP_104732839.1 | MobQ family relaxase | - |
| OGM24_RS09730 (OGM24_09730) | 2069234..2069524 | - | 291 | WP_002596328.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| OGM24_RS09735 (OGM24_09735) | 2069521..2069799 | - | 279 | WP_005924829.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OGM24_RS09740 (OGM24_09740) | 2069926..2070324 | + | 399 | WP_012816198.1 | cysteine-rich VLP domain-containing protein | - |
| OGM24_RS09745 (OGM24_09745) | 2070438..2071172 | + | 735 | WP_012816199.1 | phage replisome organizer N-terminal domain-containing protein | - |
| OGM24_RS09750 (OGM24_09750) | 2071169..2072032 | + | 864 | WP_104732840.1 | ATP-binding protein | - |
| OGM24_RS09755 (OGM24_09755) | 2072076..2072270 | + | 195 | WP_104732841.1 | transposon-encoded TnpW family protein | - |
| OGM24_RS09760 (OGM24_09760) | 2072348..2072713 | + | 366 | WP_104732842.1 | hypothetical protein | - |
| OGM24_RS09765 (OGM24_09765) | 2072808..2073389 | + | 582 | Protein_1840 | TraM recognition domain-containing protein | - |
| OGM24_RS09770 (OGM24_09770) | 2073487..2073864 | + | 378 | WP_009891894.1 | TnpV protein | - |
| OGM24_RS09775 (OGM24_09775) | 2073878..2074159 | + | 282 | WP_009891893.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Integrative and Conjugative Element | - | - | 2057288..2154768 | 97480 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11112.87 Da Isoelectric Point: 8.0630
>T260545 WP_002596328.1 NZ_CP107113:c2069524-2069234 [Clostridioides difficile]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M4XBM1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M4XB19 |