Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1718447..1718667 | Replicon | chromosome |
Accession | NZ_CP107113 | ||
Organism | Clostridioides difficile strain R_cdtRKO10.3 |
Toxin (Protein)
Gene name | CD0956.2 | Uniprot ID | Q183Z5 |
Locus tag | OGM24_RS08080 | Protein ID | WP_003429855.1 |
Coordinates | 1718447..1718608 (+) | Length | 54 a.a. |
Antitoxin (RNA)
Gene name | RCd10 | ||
Locus tag | - | ||
Coordinates | 1718528..1718667 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGM24_RS08050 (OGM24_08050) | 1714304..1714741 | + | 438 | WP_009888839.1 | hypothetical protein | - |
OGM24_RS08055 (OGM24_08055) | 1714734..1714910 | + | 177 | WP_009888840.1 | hypothetical protein | - |
OGM24_RS08060 (OGM24_08060) | 1714911..1716221 | + | 1311 | WP_009893136.1 | phage tail sheath family protein | - |
OGM24_RS08065 (OGM24_08065) | 1716238..1716708 | + | 471 | WP_009888842.1 | phage tail tube protein | - |
OGM24_RS08070 (OGM24_08070) | 1716767..1717594 | + | 828 | WP_009888843.1 | hypothetical protein | - |
OGM24_RS08075 (OGM24_08075) | 1717666..1718106 | + | 441 | WP_003429853.1 | phage portal protein | - |
OGM24_RS08080 (OGM24_08080) | 1718447..1718608 | + | 162 | WP_003429855.1 | hypothetical protein | Toxin |
- | 1718528..1718667 | - | 140 | - | - | Antitoxin |
OGM24_RS08085 (OGM24_08085) | 1719945..1720133 | + | 189 | WP_003429858.1 | hypothetical protein | - |
OGM24_RS08090 (OGM24_08090) | 1720252..1721118 | + | 867 | WP_009888845.1 | BRO family protein | - |
OGM24_RS08095 (OGM24_08095) | 1721171..1721305 | + | 135 | WP_009888846.1 | hypothetical protein | - |
OGM24_RS08100 (OGM24_08100) | 1721983..1722510 | + | 528 | WP_009888847.1 | DUF4352 domain-containing protein | - |
OGM24_RS08105 (OGM24_08105) | 1722648..1723415 | + | 768 | WP_009888848.1 | DUF4428 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1684658..1751795 | 67137 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T260542 WP_003429855.1 NZ_CP107113:1718447-1718608 [Clostridioides difficile]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
Antitoxin
Download Length: 140 bp
>AT260542 NZ_CP107113:c1718667-1718528 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|