Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1718269..1718489 | Replicon | chromosome |
Accession | NZ_CP107111 | ||
Organism | Clostridioides difficile strain R_cdtRstop4.2 |
Toxin (Protein)
Gene name | CD0956.2 | Uniprot ID | Q183Z5 |
Locus tag | OGM31_RS08085 | Protein ID | WP_003429855.1 |
Coordinates | 1718269..1718430 (+) | Length | 54 a.a. |
Antitoxin (RNA)
Gene name | RCd10 | ||
Locus tag | - | ||
Coordinates | 1718350..1718489 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGM31_RS08055 (OGM31_08055) | 1714126..1714563 | + | 438 | WP_009888839.1 | hypothetical protein | - |
OGM31_RS08060 (OGM31_08060) | 1714556..1714732 | + | 177 | WP_009888840.1 | hypothetical protein | - |
OGM31_RS08065 (OGM31_08065) | 1714733..1716043 | + | 1311 | WP_009893136.1 | phage tail sheath family protein | - |
OGM31_RS08070 (OGM31_08070) | 1716060..1716530 | + | 471 | WP_009888842.1 | phage tail tube protein | - |
OGM31_RS08075 (OGM31_08075) | 1716589..1717416 | + | 828 | WP_009888843.1 | hypothetical protein | - |
OGM31_RS08080 (OGM31_08080) | 1717488..1717928 | + | 441 | WP_003429853.1 | phage portal protein | - |
OGM31_RS08085 (OGM31_08085) | 1718269..1718430 | + | 162 | WP_003429855.1 | hypothetical protein | Toxin |
- | 1718350..1718489 | - | 140 | - | - | Antitoxin |
OGM31_RS08090 (OGM31_08090) | 1719767..1719955 | + | 189 | WP_003429858.1 | hypothetical protein | - |
OGM31_RS08095 (OGM31_08095) | 1720074..1720940 | + | 867 | WP_009888845.1 | BRO family protein | - |
OGM31_RS08100 (OGM31_08100) | 1720993..1721127 | + | 135 | WP_009888846.1 | hypothetical protein | - |
OGM31_RS08105 (OGM31_08105) | 1721805..1722332 | + | 528 | WP_009888847.1 | DUF4352 domain-containing protein | - |
OGM31_RS08110 (OGM31_08110) | 1722470..1723237 | + | 768 | WP_009888848.1 | DUF4428 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1684480..1751617 | 67137 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T260534 WP_003429855.1 NZ_CP107111:1718269-1718430 [Clostridioides difficile]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
Antitoxin
Download Length: 140 bp
>AT260534 NZ_CP107111:c1718489-1718350 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|