260533

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 2069221..2069786 Replicon chromosome
Accession NZ_CP107110
Organism Clostridioides difficile strain R_cdtRstop8

Toxin (Protein)


Gene name relE Uniprot ID C7H6P5
Locus tag OGM29_RS09745 Protein ID WP_002596328.1
Coordinates 2069221..2069511 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C7H6P4
Locus tag OGM29_RS09750 Protein ID WP_005924829.1
Coordinates 2069508..2069786 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGM29_RS09715 (OGM29_09715) 2064817..2065278 + 462 WP_012816193.1 hypothetical protein -
OGM29_RS09720 (OGM29_09720) 2065723..2066136 + 414 WP_012816194.1 sigma factor-like helix-turn-helix DNA-binding protein -
OGM29_RS09725 (OGM29_09725) 2066238..2066690 + 453 WP_012816195.1 sigma-24 (feci) -
OGM29_RS09730 (OGM29_09730) 2066701..2067162 + 462 WP_009296689.1 sigma factor-like helix-turn-helix DNA-binding protein -
OGM29_RS09735 (OGM29_09735) 2067191..2067481 + 291 WP_024739841.1 DUF3847 domain-containing protein -
OGM29_RS09740 (OGM29_09740) 2067668..2069113 + 1446 WP_104732839.1 MobQ family relaxase -
OGM29_RS09745 (OGM29_09745) 2069221..2069511 - 291 WP_002596328.1 type II toxin-antitoxin system YafQ family toxin Toxin
OGM29_RS09750 (OGM29_09750) 2069508..2069786 - 279 WP_005924829.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OGM29_RS09755 (OGM29_09755) 2069913..2070311 + 399 WP_012816198.1 cysteine-rich VLP domain-containing protein -
OGM29_RS09760 (OGM29_09760) 2070425..2071159 + 735 WP_012816199.1 phage replisome organizer N-terminal domain-containing protein -
OGM29_RS09765 (OGM29_09765) 2071156..2072019 + 864 WP_104732840.1 ATP-binding protein -
OGM29_RS09770 (OGM29_09770) 2072063..2072257 + 195 WP_104732841.1 transposon-encoded TnpW family protein -
OGM29_RS09775 (OGM29_09775) 2072335..2072700 + 366 WP_104732842.1 hypothetical protein -
OGM29_RS09780 (OGM29_09780) 2072795..2073376 + 582 Protein_1843 TraM recognition domain-containing protein -
OGM29_RS09785 (OGM29_09785) 2073474..2073851 + 378 WP_009891894.1 TnpV protein -
OGM29_RS09790 (OGM29_09790) 2073865..2074146 + 282 WP_009891893.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Integrative and Conjugative Element - - 2057275..2154755 97480


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-94)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-90)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11112.87 Da        Isoelectric Point: 8.0630

>T260533 WP_002596328.1 NZ_CP107110:c2069511-2069221 [Clostridioides difficile]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK

Download         Length: 291 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10247.66 Da        Isoelectric Point: 4.4692

>AT260533 WP_005924829.1 NZ_CP107110:c2069786-2069508 [Clostridioides difficile]
MAGNTTNISIRMDADLKAQADALFTELGMNLTTAFNIFVRQSLREGGIPFEVRLEQPNKETVAAMLEAERIAKDPSVKGY
NDLDELFADLKR

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M4XBM1

Antitoxin

Source ID Structure
AlphaFold DB A0A1M4XB19

References