Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 2069221..2069786 | Replicon | chromosome |
Accession | NZ_CP107110 | ||
Organism | Clostridioides difficile strain R_cdtRstop8 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C7H6P5 |
Locus tag | OGM29_RS09745 | Protein ID | WP_002596328.1 |
Coordinates | 2069221..2069511 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | C7H6P4 |
Locus tag | OGM29_RS09750 | Protein ID | WP_005924829.1 |
Coordinates | 2069508..2069786 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGM29_RS09715 (OGM29_09715) | 2064817..2065278 | + | 462 | WP_012816193.1 | hypothetical protein | - |
OGM29_RS09720 (OGM29_09720) | 2065723..2066136 | + | 414 | WP_012816194.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
OGM29_RS09725 (OGM29_09725) | 2066238..2066690 | + | 453 | WP_012816195.1 | sigma-24 (feci) | - |
OGM29_RS09730 (OGM29_09730) | 2066701..2067162 | + | 462 | WP_009296689.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
OGM29_RS09735 (OGM29_09735) | 2067191..2067481 | + | 291 | WP_024739841.1 | DUF3847 domain-containing protein | - |
OGM29_RS09740 (OGM29_09740) | 2067668..2069113 | + | 1446 | WP_104732839.1 | MobQ family relaxase | - |
OGM29_RS09745 (OGM29_09745) | 2069221..2069511 | - | 291 | WP_002596328.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OGM29_RS09750 (OGM29_09750) | 2069508..2069786 | - | 279 | WP_005924829.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OGM29_RS09755 (OGM29_09755) | 2069913..2070311 | + | 399 | WP_012816198.1 | cysteine-rich VLP domain-containing protein | - |
OGM29_RS09760 (OGM29_09760) | 2070425..2071159 | + | 735 | WP_012816199.1 | phage replisome organizer N-terminal domain-containing protein | - |
OGM29_RS09765 (OGM29_09765) | 2071156..2072019 | + | 864 | WP_104732840.1 | ATP-binding protein | - |
OGM29_RS09770 (OGM29_09770) | 2072063..2072257 | + | 195 | WP_104732841.1 | transposon-encoded TnpW family protein | - |
OGM29_RS09775 (OGM29_09775) | 2072335..2072700 | + | 366 | WP_104732842.1 | hypothetical protein | - |
OGM29_RS09780 (OGM29_09780) | 2072795..2073376 | + | 582 | Protein_1843 | TraM recognition domain-containing protein | - |
OGM29_RS09785 (OGM29_09785) | 2073474..2073851 | + | 378 | WP_009891894.1 | TnpV protein | - |
OGM29_RS09790 (OGM29_09790) | 2073865..2074146 | + | 282 | WP_009891893.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integrative and Conjugative Element | - | - | 2057275..2154755 | 97480 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11112.87 Da Isoelectric Point: 8.0630
>T260533 WP_002596328.1 NZ_CP107110:c2069511-2069221 [Clostridioides difficile]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M4XBM1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M4XB19 |