Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 2069205..2069770 Replicon chromosome
Accession NZ_CP107109
Organism Clostridioides difficile strain R_cdtRmut6.1

Toxin (Protein)


Gene name relE Uniprot ID C7H6P5
Locus tag OGM27_RS09735 Protein ID WP_002596328.1
Coordinates 2069205..2069495 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C7H6P4
Locus tag OGM27_RS09740 Protein ID WP_005924829.1
Coordinates 2069492..2069770 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGM27_RS09705 (OGM27_09705) 2064801..2065262 + 462 WP_012816193.1 hypothetical protein -
OGM27_RS09710 (OGM27_09710) 2065707..2066120 + 414 WP_012816194.1 sigma factor-like helix-turn-helix DNA-binding protein -
OGM27_RS09715 (OGM27_09715) 2066222..2066674 + 453 WP_012816195.1 sigma-24 (feci) -
OGM27_RS09720 (OGM27_09720) 2066685..2067146 + 462 WP_009296689.1 sigma factor-like helix-turn-helix DNA-binding protein -
OGM27_RS09725 (OGM27_09725) 2067175..2067465 + 291 WP_024739841.1 DUF3847 domain-containing protein -
OGM27_RS09730 (OGM27_09730) 2067652..2069097 + 1446 WP_104732839.1 MobQ family relaxase -
OGM27_RS09735 (OGM27_09735) 2069205..2069495 - 291 WP_002596328.1 type II toxin-antitoxin system YafQ family toxin Toxin
OGM27_RS09740 (OGM27_09740) 2069492..2069770 - 279 WP_005924829.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OGM27_RS09745 (OGM27_09745) 2069897..2070295 + 399 WP_012816198.1 cysteine-rich VLP domain-containing protein -
OGM27_RS09750 (OGM27_09750) 2070409..2071143 + 735 WP_012816199.1 phage replisome organizer N-terminal domain-containing protein -
OGM27_RS09755 (OGM27_09755) 2071140..2072003 + 864 WP_104732840.1 ATP-binding protein -
OGM27_RS09760 (OGM27_09760) 2072047..2072241 + 195 WP_104732841.1 transposon-encoded TnpW family protein -
OGM27_RS09765 (OGM27_09765) 2072319..2072684 + 366 WP_104732842.1 hypothetical protein -
OGM27_RS09770 (OGM27_09770) 2072779..2073360 + 582 Protein_1841 TraM recognition domain-containing protein -
OGM27_RS09775 (OGM27_09775) 2073458..2073835 + 378 WP_009891894.1 TnpV protein -
OGM27_RS09780 (OGM27_09780) 2073849..2074130 + 282 WP_009891893.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Integrative and Conjugative Element - - 2057259..2154739 97480


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-94)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-90)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11112.87 Da        Isoelectric Point: 8.0630

>T260529 WP_002596328.1 NZ_CP107109:c2069495-2069205 [Clostridioides difficile]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK

Download         Length: 291 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10247.66 Da        Isoelectric Point: 4.4692

>AT260529 WP_005924829.1 NZ_CP107109:c2069770-2069492 [Clostridioides difficile]
MAGNTTNISIRMDADLKAQADALFTELGMNLTTAFNIFVRQSLREGGIPFEVRLEQPNKETVAAMLEAERIAKDPSVKGY
NDLDELFADLKR

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M4XBM1

Antitoxin

Source ID Structure
AlphaFold DB A0A1M4XB19

References