260525

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 2097338..2097903 Replicon chromosome
Accession NZ_CP107108
Organism Clostridioides difficile strain R_phiCD75-3

Toxin (Protein)


Gene name relE Uniprot ID C7H6P5
Locus tag OGM26_RS09980 Protein ID WP_002596328.1
Coordinates 2097338..2097628 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C7H6P4
Locus tag OGM26_RS09985 Protein ID WP_005924829.1
Coordinates 2097625..2097903 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGM26_RS09950 (OGM26_09950) 2092934..2093395 + 462 WP_012816193.1 hypothetical protein -
OGM26_RS09955 (OGM26_09955) 2093840..2094253 + 414 WP_012816194.1 sigma factor-like helix-turn-helix DNA-binding protein -
OGM26_RS09960 (OGM26_09960) 2094355..2094807 + 453 WP_012816195.1 sigma-24 (feci) -
OGM26_RS09965 (OGM26_09965) 2094818..2095279 + 462 WP_009296689.1 sigma factor-like helix-turn-helix DNA-binding protein -
OGM26_RS09970 (OGM26_09970) 2095308..2095598 + 291 WP_024739841.1 DUF3847 domain-containing protein -
OGM26_RS09975 (OGM26_09975) 2095785..2097230 + 1446 WP_104732839.1 MobQ family relaxase -
OGM26_RS09980 (OGM26_09980) 2097338..2097628 - 291 WP_002596328.1 type II toxin-antitoxin system YafQ family toxin Toxin
OGM26_RS09985 (OGM26_09985) 2097625..2097903 - 279 WP_005924829.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OGM26_RS09990 (OGM26_09990) 2098030..2098428 + 399 WP_012816198.1 cysteine-rich VLP domain-containing protein -
OGM26_RS09995 (OGM26_09995) 2098542..2099276 + 735 WP_012816199.1 phage replisome organizer N-terminal domain-containing protein -
OGM26_RS10000 (OGM26_10000) 2099273..2100136 + 864 WP_104732840.1 ATP-binding protein -
OGM26_RS10005 (OGM26_10005) 2100180..2100374 + 195 WP_104732841.1 transposon-encoded TnpW family protein -
OGM26_RS10010 (OGM26_10010) 2100452..2100817 + 366 WP_104732842.1 hypothetical protein -
OGM26_RS10015 (OGM26_10015) 2100912..2101493 + 582 Protein_1890 TraM recognition domain-containing protein -
OGM26_RS10020 (OGM26_10020) 2101591..2101968 + 378 WP_009891894.1 TnpV protein -
OGM26_RS10025 (OGM26_10025) 2101982..2102263 + 282 WP_009891893.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Integrative and Conjugative Element - - 2085392..2182872 97480


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-94)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-90)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11112.87 Da        Isoelectric Point: 8.0630

>T260525 WP_002596328.1 NZ_CP107108:c2097628-2097338 [Clostridioides difficile]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK

Download         Length: 291 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10247.66 Da        Isoelectric Point: 4.4692

>AT260525 WP_005924829.1 NZ_CP107108:c2097903-2097625 [Clostridioides difficile]
MAGNTTNISIRMDADLKAQADALFTELGMNLTTAFNIFVRQSLREGGIPFEVRLEQPNKETVAAMLEAERIAKDPSVKGY
NDLDELFADLKR

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M4XBM1

Antitoxin

Source ID Structure
AlphaFold DB A0A1M4XB19

References