Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 1746550..1746770 | Replicon | chromosome |
| Accession | NZ_CP107108 | ||
| Organism | Clostridioides difficile strain R_phiCD75-3 | ||
Toxin (Protein)
| Gene name | CD0956.2 | Uniprot ID | Q183Z5 |
| Locus tag | OGM26_RS08320 | Protein ID | WP_003429855.1 |
| Coordinates | 1746550..1746711 (+) | Length | 54 a.a. |
Antitoxin (RNA)
| Gene name | RCd10 | ||
| Locus tag | - | ||
| Coordinates | 1746631..1746770 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGM26_RS08290 (OGM26_08290) | 1742407..1742844 | + | 438 | WP_009888839.1 | hypothetical protein | - |
| OGM26_RS08295 (OGM26_08295) | 1742837..1743013 | + | 177 | WP_009888840.1 | hypothetical protein | - |
| OGM26_RS08300 (OGM26_08300) | 1743014..1744324 | + | 1311 | WP_009893136.1 | phage tail sheath family protein | - |
| OGM26_RS08305 (OGM26_08305) | 1744341..1744811 | + | 471 | WP_009888842.1 | phage tail tube protein | - |
| OGM26_RS08310 (OGM26_08310) | 1744870..1745697 | + | 828 | WP_009888843.1 | hypothetical protein | - |
| OGM26_RS08315 (OGM26_08315) | 1745769..1746209 | + | 441 | WP_003429853.1 | phage portal protein | - |
| OGM26_RS08320 (OGM26_08320) | 1746550..1746711 | + | 162 | WP_003429855.1 | hypothetical protein | Toxin |
| - | 1746631..1746770 | - | 140 | - | - | Antitoxin |
| OGM26_RS08325 (OGM26_08325) | 1748048..1748236 | + | 189 | WP_003429858.1 | hypothetical protein | - |
| OGM26_RS08330 (OGM26_08330) | 1748355..1749221 | + | 867 | WP_009888845.1 | BRO family protein | - |
| OGM26_RS08335 (OGM26_08335) | 1749274..1749408 | + | 135 | WP_009888846.1 | hypothetical protein | - |
| OGM26_RS08340 (OGM26_08340) | 1750086..1750613 | + | 528 | WP_009888847.1 | DUF4352 domain-containing protein | - |
| OGM26_RS08345 (OGM26_08345) | 1750751..1751518 | + | 768 | WP_009888848.1 | DUF4428 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1712761..1779199 | 66438 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T260522 WP_003429855.1 NZ_CP107108:1746550-1746711 [Clostridioides difficile]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
Antitoxin
Download Length: 140 bp
>AT260522 NZ_CP107108:c1746770-1746631 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|