Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) CD-RCd/-
Location 1326278..1326480 Replicon chromosome
Accession NZ_CP107108
Organism Clostridioides difficile strain R_phiCD75-3

Toxin (Protein)


Gene name CD2299.1 Uniprot ID Q185H1
Locus tag OGM26_RS06275 Protein ID WP_004454589.1
Coordinates 1326278..1326430 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name SQ1641
Locus tag -
Coordinates 1326351..1326480 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGM26_RS06230 (OGM26_06230) 1321627..1322028 + 402 WP_263719387.1 hypothetical protein -
OGM26_RS06235 (OGM26_06235) 1322022..1322369 + 348 WP_263719389.1 hypothetical protein -
OGM26_RS06240 (OGM26_06240) 1322423..1322794 + 372 WP_074092173.1 HK97 gp10 family phage protein -
OGM26_RS06245 (OGM26_06245) 1322787..1323224 + 438 WP_107635321.1 hypothetical protein -
OGM26_RS06250 (OGM26_06250) 1323217..1323393 + 177 WP_074092175.1 hypothetical protein -
OGM26_RS06255 (OGM26_06255) 1323394..1324704 + 1311 WP_263719390.1 phage tail sheath family protein -
OGM26_RS06260 (OGM26_06260) 1324724..1325200 + 477 WP_009901461.1 phage tail tube protein -
OGM26_RS06265 (OGM26_06265) 1325253..1325510 + 258 WP_038812175.1 hypothetical protein -
OGM26_RS06270 (OGM26_06270) 1325512..1325952 + 441 WP_022618880.1 hypothetical protein -
OGM26_RS06275 (OGM26_06275) 1326278..1326430 + 153 WP_004454589.1 hypothetical protein Toxin
- 1326351..1326480 - 130 - - Antitoxin
OGM26_RS06280 (OGM26_06280) 1326569..1326802 + 234 WP_263719391.1 hypothetical protein -
OGM26_RS06285 (OGM26_06285) 1326799..1327008 - 210 WP_263719392.1 hypothetical protein -
OGM26_RS06290 (OGM26_06290) 1327272..1327832 + 561 WP_263719393.1 ribosomal protein L7/L12 -
OGM26_RS06295 (OGM26_06295) 1327910..1330198 + 2289 WP_263719394.1 tape measure protein -
OGM26_RS06300 (OGM26_06300) 1330214..1330903 + 690 WP_263719396.1 LysM peptidoglycan-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1298748..1344376 45628


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.92 Da        Isoelectric Point: 10.6365

>T260520 WP_004454589.1 NZ_CP107108:1326278-1326430 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK

Download         Length: 153 bp

Antitoxin


Download         Length: 130 bp

>AT260520 NZ_CP107108:c1326480-1326351 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A125V725

Antitoxin

Download structure file

References