Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 1326278..1326480 | Replicon | chromosome |
| Accession | NZ_CP107108 | ||
| Organism | Clostridioides difficile strain R_phiCD75-3 | ||
Toxin (Protein)
| Gene name | CD2299.1 | Uniprot ID | Q185H1 |
| Locus tag | OGM26_RS06275 | Protein ID | WP_004454589.1 |
| Coordinates | 1326278..1326430 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | SQ1641 | ||
| Locus tag | - | ||
| Coordinates | 1326351..1326480 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGM26_RS06230 (OGM26_06230) | 1321627..1322028 | + | 402 | WP_263719387.1 | hypothetical protein | - |
| OGM26_RS06235 (OGM26_06235) | 1322022..1322369 | + | 348 | WP_263719389.1 | hypothetical protein | - |
| OGM26_RS06240 (OGM26_06240) | 1322423..1322794 | + | 372 | WP_074092173.1 | HK97 gp10 family phage protein | - |
| OGM26_RS06245 (OGM26_06245) | 1322787..1323224 | + | 438 | WP_107635321.1 | hypothetical protein | - |
| OGM26_RS06250 (OGM26_06250) | 1323217..1323393 | + | 177 | WP_074092175.1 | hypothetical protein | - |
| OGM26_RS06255 (OGM26_06255) | 1323394..1324704 | + | 1311 | WP_263719390.1 | phage tail sheath family protein | - |
| OGM26_RS06260 (OGM26_06260) | 1324724..1325200 | + | 477 | WP_009901461.1 | phage tail tube protein | - |
| OGM26_RS06265 (OGM26_06265) | 1325253..1325510 | + | 258 | WP_038812175.1 | hypothetical protein | - |
| OGM26_RS06270 (OGM26_06270) | 1325512..1325952 | + | 441 | WP_022618880.1 | hypothetical protein | - |
| OGM26_RS06275 (OGM26_06275) | 1326278..1326430 | + | 153 | WP_004454589.1 | hypothetical protein | Toxin |
| - | 1326351..1326480 | - | 130 | - | - | Antitoxin |
| OGM26_RS06280 (OGM26_06280) | 1326569..1326802 | + | 234 | WP_263719391.1 | hypothetical protein | - |
| OGM26_RS06285 (OGM26_06285) | 1326799..1327008 | - | 210 | WP_263719392.1 | hypothetical protein | - |
| OGM26_RS06290 (OGM26_06290) | 1327272..1327832 | + | 561 | WP_263719393.1 | ribosomal protein L7/L12 | - |
| OGM26_RS06295 (OGM26_06295) | 1327910..1330198 | + | 2289 | WP_263719394.1 | tape measure protein | - |
| OGM26_RS06300 (OGM26_06300) | 1330214..1330903 | + | 690 | WP_263719396.1 | LysM peptidoglycan-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1298748..1344376 | 45628 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T260520 WP_004454589.1 NZ_CP107108:1326278-1326430 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
Antitoxin
Download Length: 130 bp
>AT260520 NZ_CP107108:c1326480-1326351 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|